TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000022_1.0 # Protein # Methionine-R-sufoxide reductase 2 (SelR2) # Homo sapiens # Complete (199 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5668 | | 1 to 2542 84 8e-17 >Lt_contig5668 | | 1 to 2542 Length = 2542 Score = 83.6 bits (205), Expect = 8e-17 Identities = 47/150 (31%), Positives = 70/150 (46%), Gaps = 11/150 (7%) Frame = -1 Query: 58 SLATCELPLAK--------SEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVC 109 S C PL K +EW++ LT ++++ REKGT+P G Y + G Y C Sbjct: 1534 SRTNCAGPLEKDGSKDVSDAEWRRVLTAHEYHILREKGTDP-VGGKYDEVFDEGEYVCAG 1358 Query: 110 CDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAH 169 C +PL+ S K+ G GWP F + ++ R E+VC C +H Sbjct: 1357 CQTPLYLSSMKFACGCGWPGFYDCIPKKVREQ----------PDKDGRRVEIVCNACNSH 1208 Query: 170 LGHVFPDGPGPN---GQRFCINSVALKFKP 196 LGH+F PN +R C+NS ++ +P Sbjct: 1207 LGHIFRGEGFPNPPPNERHCVNSTSIILRP 1118 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.316 0.133 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,968,139 Number of Sequences: 7267 Number of extensions: 171710 Number of successful extensions: 1074 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of query: 199 length of database: 10,532,946 effective HSP length: 94 effective length of query: 105 effective length of database: 9,849,848 effective search space: 1034234040 effective search space used: 1034234040 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 101 (43.5 bits)