TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000022_1.0 # Protein # Methionine-R-sufoxide reductase 2 (SelR2) # Homo sapiens # Complete (199 letters) Database: L.donovani_BPK282A1/genome.fa 36 sequences; 32,444,998 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value contig_28 84 9e-17 >contig_28 Length = 1171725 Score = 83.6 bits (205), Expect = 9e-17 Identities = 46/137 (33%), Positives = 71/137 (51%), Gaps = 6/137 (4%) Frame = +1 Query: 66 LAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGT 125 ++ EW++ LT +++++ REKGT+P G Y + + G Y C C +PL+ S K+ G Sbjct: 1054267 MSDEEWRRILTAQEYHILREKGTDP-VGGKYDDVFDEGEYVCAGCKTPLYLSSMKFACGC 1054443 Query: 126 GWPSFSEAHGTSGSDESHTGILRRL--DTSLGSARTEVVCKQCEAHLGHVFPD----GPG 179 GWP F + I +R+ R E+VC C +HLGHVF P Sbjct: 1054444 GWPGFYDC------------IPKRVREQPDKDGRRVEIVCNACNSHLGHVFRKEGFRNPP 1054587 Query: 180 PNGQRFCINSVALKFKP 196 PN +R C+NS ++ +P Sbjct: 1054588 PN-ERHCVNSTSIILRP 1054635 Database: L.donovani_BPK282A1/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 32,444,998 Number of sequences in database: 36 Lambda K H 0.316 0.133 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,197,387 Number of Sequences: 36 Number of extensions: 176858 Number of successful extensions: 1054 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 967 Number of HSP's gapped (non-prelim): 275 length of query: 199 length of database: 10,814,999 effective HSP length: 95 effective length of query: 104 effective length of database: 10,811,579 effective search space: 1124404216 effective search space used: 1124404216 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 101 (43.5 bits)