TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000022_1.0 # Protein # Methionine-R-sufoxide reductase 2 (SelR2) # Homo sapiens # Complete (199 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig980 | | 1 to 109705 87 7e-18 >Cf_Contig980 | | 1 to 109705 Length = 109705 Score = 87.4 bits (215), Expect = 7e-18 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 4/133 (3%) Frame = +2 Query: 68 KSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGW 127 ++EW+ LTP Q+ + REKGT+P G Y + E G Y C C +PL++S K+ G GW Sbjct: 4742 EAEWKAILTPTQYRILREKGTDP-VGGKYDDLFEDGEYVCAACKTPLYTSAMKFACGCGW 4918 Query: 128 PSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPD----GPGPNGQ 183 P F + + +R L G R E+VC C +HLGHVF + P PN + Sbjct: 4919 PGFWDCIPKT---------VRELPDKDG-RRVEIVCNACNSHLGHVFRNEGFRNPPPN-E 5065 Query: 184 RFCINSVALKFKP 196 R C+N+ ++ F P Sbjct: 5066 RHCVNNTSVIFIP 5104 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.316 0.133 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,978,769 Number of Sequences: 1089 Number of extensions: 184772 Number of successful extensions: 1238 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 71 Number of HSP's that attempted gapping in prelim test: 934 Number of HSP's gapped (non-prelim): 624 length of query: 199 length of database: 12,349,441 effective HSP length: 96 effective length of query: 103 effective length of database: 12,244,897 effective search space: 1261224391 effective search space used: 1261224391 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 102 (43.9 bits)