TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000021_1.0 # Protein # Methionine-R-sufoxide reductase 1 (SelR1) # Homo sapiens # Complete (116 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig5668 | | 1 to 2542 50 3e-07 >Lt_contig5668 | | 1 to 2542 Length = 2542 Score = 50.1 bits (118), Expect = 3e-07 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 2/102 (1%) Frame = -1 Query: 9 GEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALK 68 G + F+ G YVCA C L+ S K+A WP F + I V ++P+ + ++ Sbjct: 1408 GGKYDEVFDEGEYVCAGCQTPLYLSSMKFACGCGWPGFYDCI-PKKVREQPDKD-GRRVE 1235 Query: 69 VSCGKCGNGLGHEFLNDG--PKPGQSRFUIFSSSLKFVPKGK 108 + C C + LGH F +G P R + S+S+ P K Sbjct: 1234 IVCNACNSHLGHIFRGEGFPNPPPNERHCVNSTSIILRPTQK 1109 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.318 0.134 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,855,771 Number of Sequences: 7267 Number of extensions: 135513 Number of successful extensions: 777 Number of sequences better than 1.0e-04: 1 Number of HSP's better than 0.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of query: 116 length of database: 10,532,946 effective HSP length: 86 effective length of query: 30 effective length of database: 9,907,984 effective search space: 297239520 effective search space used: 297239520 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 96 (41.6 bits)