TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelL_ciona_intestinalis received from V.Shchedrina (303 letters) Database: C.fasciculata/genome.fa 1089 sequences; 37,048,325 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value Cf_Contig958 | | 1 to 53326 30 3.3 Cf_Contig1055 | | 1 to 461976 28 7.3 >Cf_Contig958 | | 1 to 53326 Length = 53326 Score = 29.6 bits (65), Expect = 3.3 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -2 Query: 223 RSVAKVYNCNALSLYGLAKATFEEIPKQYKDIHDDPQQ 260 R AKV NCNA AT E + KD DDP+Q Sbjct: 44499 RFTAKVPNCNA--------ATLEHLLMDDKDFRDDPEQ 44410 >Cf_Contig1055 | | 1 to 461976 Length = 461976 Score = 28.5 bits (62), Expect = 7.3 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 223 RSVAKVYNCNALSLYGLAKATFEEIPKQYKDIHDDPQQ 260 R AKV NCNA AT E + KD DDP++ Sbjct: 411717 RFTAKVPNCNA--------ATLEHLLMDDKDFRDDPEE 411806 Database: C.fasciculata/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 37,048,325 Number of sequences in database: 1089 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,264,573 Number of Sequences: 1089 Number of extensions: 125187 Number of successful extensions: 474 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 429 Number of HSP's gapped (non-prelim): 99 length of query: 303 length of database: 12,349,441 effective HSP length: 101 effective length of query: 202 effective length of database: 12,239,452 effective search space: 2472369304 effective search space used: 2472369304 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 61 (28.1 bits)