TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelL_ciona_intestinalis received from V.Shchedrina (303 letters) Database: P.capsici/genome.fa 917 sequences; 64,023,748 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value PHYCAscaffold_73 35 0.17 PHYCAscaffold_34 31 2.5 PHYCAscaffold_60 29 7.3 >PHYCAscaffold_73 Length = 348431 Score = 34.7 bits (78), Expect = 0.17 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 2/120 (1%) Frame = -2 Query: 10 NVFVQTGYNVKKKAENIMKDVGVKQFVETKL-GSLLGLISAYENLFCETKSCNRAALDKT 68 + FVQ + K+ +N+M ++G+KQ +ET L LL +++ Y ET + N A+ KT Sbjct: 156169 DAFVQFWIHRKETPDNVMVELGLKQSMETLLENPLLNILTKY----TETYNIN-YAVKKT 156005 Query: 69 LQVLYRQQSAGNEAVESLLTFEEDWDKF-LEEIDQSMFGEISTPTLAVGDKIPDDITLIN 127 V ++ G+E V ++L +KF +EI + + L G + D L+N Sbjct: 156004 TVVETLTRAFGDETVATMLLAGR--EKFTTKEIAKQFQADQVEMWLNSGQSVDDVYKLLN 155831 Score = 29.6 bits (65), Expect = 5.6 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -1 Query: 10 NVFVQTGYNVKKKAENIMKDVGVKQFVETKLGS-LLGLISAYENLFCETKSCNRAALDKT 68 + FVQ + K+ +N+M ++G+KQ +T L S LL +++ Y + + + + +T Sbjct: 222446 DAFVQFWIHRKETPDNVMVELGLKQSTKTLLESPLLNILTKYTEAYNVNFATKKTTVIET 222267 Query: 69 L 69 L Sbjct: 222266 L 222264 >PHYCAscaffold_34 Length = 622686 Score = 30.8 bits (68), Expect = 2.5 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (8%) Frame = +1 Query: 13 VQTGYNVKKKAENIMKDVGVKQFVETKLGS------LLGLISAYENLFCETKSCNRAALD 66 V+ Y V K +I+K K+ V TK G+ L+ + NLF ++SC R A Sbjct: 292111 VRNEYIVDPKTSDIVK----KRVVVTKGGAFPEGSTLIRKLRTLNNLFSSSRSCERIARL 292278 Query: 67 KTLQVLYR 74 K +Q+ +R Sbjct: 292279 KQVQIFHR 292302 >PHYCAscaffold_60 Length = 366873 Score = 29.3 bits (64), Expect = 7.3 Identities = 13/48 (27%), Positives = 29/48 (60%) Frame = -1 Query: 169 IQEKQDEFSQLKCSIILVSFGEEAGADLWLKETKFSFPMYLDKQRKIY 216 + ++QDE +L +F + G ++ ++ +SF +Y+DK+R++Y Sbjct: 308124 LPDQQDELCELLFEFYRKNFRKPEGEFIF-PDSDYSFDVYVDKRRRVY 307984 Database: P.capsici/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 64,023,748 Number of sequences in database: 917 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,378,771 Number of Sequences: 917 Number of extensions: 228592 Number of successful extensions: 925 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 764 Number of HSP's gapped (non-prelim): 350 length of query: 303 length of database: 21,341,249 effective HSP length: 104 effective length of query: 199 effective length of database: 21,245,881 effective search space: 4227930319 effective search space used: 4227930319 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 63 (28.9 bits)