TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aureococcus anophagefferens (108 letters) Database: S.arctica/genome.fa 15,618 sequences; 121,588,341 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.693 of Sphaeroforma arctica JP610 29 1.8 supercont1.948 of Sphaeroforma arctica JP610 29 2.3 supercont1.311 of Sphaeroforma arctica JP610 28 3.0 supercont1.1194 of Sphaeroforma arctica JP610 28 5.1 supercont1.119 of Sphaeroforma arctica JP610 27 6.7 supercont1.278 of Sphaeroforma arctica JP610 27 8.7 >supercont1.693 of Sphaeroforma arctica JP610 Length = 49798 Score = 29.3 bits (64), Expect = 1.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 24 HLETLLTDCLQCCIKEEEFKHE 45 H T + C+QCC++E+ F H+ Sbjct: 11589 HTHTPIHTCMQCCLQEKPFHHK 11524 >supercont1.948 of Sphaeroforma arctica JP610 Length = 29395 Score = 28.9 bits (63), Expect = 2.3 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -3 Query: 25 LETLLTDCLQCCIKEEEFKHEK---YPTAILEVCEC 57 L+TL +C C EE K Y TAIL VC C Sbjct: 21260 LQTLARECTPCQSSGEESKRRPCIHYDTAIL*VCNC 21153 >supercont1.311 of Sphaeroforma arctica JP610 Length = 90105 Score = 28.5 bits (62), Expect = 3.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 32 CLQCCIKEEEFKHEKYPTAILEVCECNLARFPQVQA 67 C CCI +E K EKY CNL++F +V A Sbjct: 69015 CTTCCITDELMKAEKY--------LCNLSQFVKVVA 69098 >supercont1.1194 of Sphaeroforma arctica JP610 Length = 19969 Score = 27.7 bits (60), Expect = 5.1 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +1 Query: 6 GFNPETLKCGLCERLSDYHLETLLTDCLQCCIKEEEF---KHEKYPTAILEVCECNLARF 62 G NP+TL GLC + + TL T C +K F +H+ P + C A F Sbjct: 15763 GVNPKTLGTGLCLQG*RANPRTLSTTCACALLKRSHF*DYEHDFQPASYTRC*FCIKASF 15942 >supercont1.119 of Sphaeroforma arctica JP610 Length = 147285 Score = 27.3 bits (59), Expect = 6.7 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -1 Query: 22 DYHLETLLTDCLQCCI----KEEEFKHEKYPTAILEVCECN 58 DY+ +T+ T C CCI + E+F KY I E+CE N Sbjct: 2721 DYNKKTVDTYCDGCCICLFDQYEDF*SHKY--LIQEICEGN 2605 >supercont1.278 of Sphaeroforma arctica JP610 Length = 96050 Score = 26.9 bits (58), Expect = 8.7 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 12 LKCGLCERLSDYHLETLLTDCLQCCIKEEEFKHEKYPTAILEVCEC 57 L CG+C YH + +DCL C + + K+ K + EC Sbjct: 5189 LPCGVCTDDVSYHC--IESDCLLCAFRYQVHKYSKAYGSGCTAVEC 5320 Database: S.arctica/genome.fa Posted date: Nov 21, 2011 7:47 PM Number of letters in database: 121,588,341 Number of sequences in database: 15,618 Lambda K H 0.324 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,551,097 Number of Sequences: 15618 Number of extensions: 295909 Number of successful extensions: 1905 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1905 length of query: 108 length of database: 40,529,447 effective HSP length: 82 effective length of query: 26 effective length of database: 39,248,771 effective search space: 1020468046 effective search space used: 1020468046 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 58 (26.9 bits)