TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|70870239|gb|AAHK01001632.1|:subseq(1423,2260) Trypanosoma cruzi strain CL Brener tcruzi_1047053508727, whole genome shotgun sequence:[translate(1)] (89 letters) Database: T.trahens/genome.fa 131 sequences; 28,680,627 total letters Searching.................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL349468.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 29 0.41 gb|GL349441.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 29 0.41 gb|GL349471.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 28 0.92 gb|GL349443.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 28 1.2 gb|GL349481.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 27 1.6 gb|GL349478.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 27 1.6 gb|GL349447.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 27 1.6 gb|GL349466.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 27 2.0 gb|GL349439.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 27 2.0 gb|GL349501.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 3.5 gb|GL349437.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 3.5 gb|GL349482.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 4.6 gb|GL349475.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 4.6 gb|GL349454.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 4.6 gb|GL349445.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 4.6 gb|GL349440.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 26 4.6 gb|GL349433.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 6.0 gb|GL349488.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349473.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349465.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349458.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349455.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349451.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349450.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349449.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 gb|GL349435.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 25 7.8 >gb|GL349468.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.36, whole genome shotgun sequence Length = 367059 Score = 29.3 bits (64), Expect = 0.41 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 56 PFGGGRSVGHAPRGPNIHGLPKGSLTGG 83 P GGG GH GP I G GS+ G Sbjct: 22480 PVGGGAGSGHLSAGPGIGGHDGGSVVSG 22397 Score = 25.0 bits (53), Expect = 7.8 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -3 Query: 59 GGRSVGH--APRGPNIHGLPKGSLT 81 GGR H APR P HGL G T Sbjct: 269164 GGRHCAHLLAPRPPQTHGLVAGRQT 269090 Score = 25.0 bits (53), Expect = 7.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 58 GGGRSVGHAPRGPNIHGLPKGSLTGGC 84 GGGR GH+ RG ++ G K S GC Sbjct: 237465 GGGRRCGHSARG-SVAGQGKRSGRRGC 237388 >gb|GL349441.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.9, whole genome shotgun sequence Length = 584593 Score = 29.3 bits (64), Expect = 0.41 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 49 RSTTRIVPFGGGRSVGHAPRGPNIHGLPKGSLTGGCATGUR 89 R + + P GGR+ H PR P +HG + G A R Sbjct: 2558 RRSHSVGPMRGGRAPRHRPRPPGVHGCVRPRRVAGRARRAR 2680 >gb|GL349471.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.39, whole genome shotgun sequence Length = 339809 Score = 28.1 bits (61), Expect = 0.92 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -1 Query: 32 FATLVSSEPVSQHVQEYRSTTRIVPFGGGRSVGHAPRG 69 FAT + P H Q Y R G G +GH P G Sbjct: 311108 FATATALSPTPSHTQTYHG*QRRHCSGHGPPLGHLPEG 310995 Score = 26.6 bits (57), Expect = 2.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 Query: 49 RSTTRIVPFGGGRSVGHAPRGPNIHGLPKGSLTGGCATGUR 89 R R+ P GGR+ H R P +HG + G A R Sbjct: 335159 RRGCRVGPVCGGRAPRHRARPPRVHGRVRPRRVAGRARRAR 335037 >gb|GL349443.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.11, whole genome shotgun sequence Length = 571036 Score = 27.7 bits (60), Expect = 1.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 56 PFGG--GRSVGHAPRGPNIHGLPKGSLTGGC 84 P GG GRSVG A HG P+ GGC Sbjct: 480609 PVGGVVGRSVGLAQGSGRWHGRPRSQGRGGC 480701 >gb|GL349481.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.49, whole genome shotgun sequence Length = 315374 Score = 27.3 bits (59), Expect = 1.6 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 55 VPFGGGRSVGHAPRGPNIHGLPKGSLTGGCA 85 VP+ S GHAPRG HGL G GCA Sbjct: 108265 VPYCASHSYGHAPRG---HGLLGGRT--GCA 108342 Score = 25.8 bits (55), Expect = 4.6 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 Query: 47 EYRSTTRIVPFGGGRSVGHAPRGPNIHGLPKGSLTGGCATG 87 E+ TT GGG G G H +G GGCATG Sbjct: 192979 EWAVTTDGRRTGGGWRGGGGGGGGGEHR*EEGDYCGGCATG 192857 >gb|GL349478.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.46, whole genome shotgun sequence Length = 304656 Score = 27.3 bits (59), Expect = 1.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 61 RSVGHAPRGPNIHGLPKGSLTGG 83 RSV H PR P G P G+ GG Sbjct: 40708 RSVRHLPRRPGTRGKPGGAAGGG 40776 >gb|GL349447.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.15, whole genome shotgun sequence Length = 583276 Score = 27.3 bits (59), Expect = 1.6 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 26 RLMWLFFATLVSSEPVSQHVQEYRSTTRIVPFGGGRSVGHAPRGPNIHGLPKGSLT 81 RL+ A+ SS P+S + G RS HAP G IHG+ S T Sbjct: 105928 RLLSTATASRASSPPLSPEASKS---------SGARSSWHAPPGHGIHGMTSPSST 106068 Score = 25.8 bits (55), Expect = 4.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 60 GRSVGHAPRGPNIHGLPKGSLTGGC 84 GR G GPN+ G P G GGC Sbjct: 118554 GRDAG----GPNVRGWPCGLCCGGC 118492 >gb|GL349466.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.34, whole genome shotgun sequence Length = 390530 Score = 26.9 bits (58), Expect = 2.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 2 PYVANGRVVDSKPFSLVDF 20 P A RV+D +PF L+DF Sbjct: 359840 PAEAGSRVIDDEPFELIDF 359896 >gb|GL349439.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.7, whole genome shotgun sequence Length = 618594 Score = 26.9 bits (58), Expect = 2.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +3 Query: 39 EPVSQHV----QEYRSTTRIVPFGGGRSVGHAPRGPNIHGLP 76 +P+ ++V +YRST +I+ V H+PR HG P Sbjct: 308877 QPLKRYVVDEPTDYRSTYQIMASAVPDPVSHSPRPATAHGAP 309002 Score = 26.2 bits (56), Expect = 3.5 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 59 GGRSVGHAPR--GPNIHGLPKGSLTGGCATG 87 GGR+ G R G I G KGS GGCA G Sbjct: 192372 GGRARGEVVRVDGELIAGGRKGSRRGGCAGG 192280 >gb|GL349501.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.69, whole genome shotgun sequence Length = 134945 Score = 26.2 bits (56), Expect = 3.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 33 ATLVSSEPVSQHVQEYRSTTRIVPFGGGRSVGHAPRGPNIHG 74 A + E +S H EYR+ R+V V H R ++HG Sbjct: 88431 AASLRRELLSDHFSEYRTIKRVVLLQQPPRVRHRHRKHHLHG 88306 >gb|GL349437.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.5, whole genome shotgun sequence Length = 654703 Score = 26.2 bits (56), Expect = 3.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 58 GGGRSVGHAPRGPNIHGLPKGSLTGGC 84 GG VG PRG G +G L G C Sbjct: 127756 GGAGRVGWPPRGSPAQGCGEGPLVGPC 127676 >gb|GL349482.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.50, whole genome shotgun sequence Length = 300393 Score = 25.8 bits (55), Expect = 4.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 58 GGGRSVGHAPRGPNIHGLPKGSLTGGCA 85 GGG G G + + L G + GGCA Sbjct: 166194 GGGEGAGREEGGESTYHLSGGPVWGGCA 166277 >gb|GL349475.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.43, whole genome shotgun sequence Length = 324729 Score = 25.8 bits (55), Expect = 4.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 58 GGGRSVGHAPRGPNIHGLPKGSLTGGC 84 GGGR GH RGP + S G C Sbjct: 95041 GGGRRTGHRRRGPRPRRGRRPSCAGMC 95121 >gb|GL349454.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.22, whole genome shotgun sequence Length = 456871 Score = 25.8 bits (55), Expect = 4.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 63 VGHAPRGPNIHGLPKGSLTGGCATG 87 VG+ G + HG P ++ GGC+ G Sbjct: 110447 VGNGKGGADHHGAPFPAVVGGCSEG 110373 >gb|GL349445.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.13, whole genome shotgun sequence Length = 561051 Score = 25.8 bits (55), Expect = 4.6 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -2 Query: 11 DSKPFSLVDFFLSILRLMWLFFATLVSSEPVSQHV 45 +++P S FF S++ W+ + L+ +EPV+ + Sbjct: 252146 NARPASERAFFTSLVASAWIMLSLLMRTEPVTSMI 252042 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 61 RSVGHAPRGPNIHGLPKG--SLTGGCA 85 RS +P GP +HG P+ + +G CA Sbjct: 540591 RSRPRSPHGPGLHGSPRSVRTTSGTCA 540511 >gb|GL349440.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.8, whole genome shotgun sequence Length = 609142 Score = 25.8 bits (55), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 53 RIVPFGGGRSVGHAPRGPNI-HGLPKGSLTGGCATGUR 89 R PF GR VG APR P G G G C R Sbjct: 541598 RSAPFRLGRDVGLAPRAPQRGAGGSSGQAGGDCGRNGR 541711 >gb|GL349433.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.1, whole genome shotgun sequence Length = 716227 Score = 25.4 bits (54), Expect = 6.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 70 PNIHGLPKGSLTGGCATG 87 P++ G P+ TG CATG Sbjct: 574610 PSVSGFPRPCATGPCATG 574663 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 44 HVQEYRSTTRIVPFGGGRSVGHAPR 68 H Y S R +GG SV H PR Sbjct: 231048 HTHTYASLLRTHTYGGHTSVHHTPR 230974 >gb|GL349488.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.56, whole genome shotgun sequence Length = 238995 Score = 25.0 bits (53), Expect = 7.8 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 49 RSTTRIVPFGGGRSVGHAPRGPNIHGLPK 77 RS TR GGRS+GHA R P H K Sbjct: 127389 RSFTRSFVCLGGRSLGHA-RAPRSHHTDK 127306 >gb|GL349473.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.41, whole genome shotgun sequence Length = 350512 Score = 25.0 bits (53), Expect = 7.8 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -1 Query: 29 WLFFATLVSSEPVSQHVQEYRSTTRIVPFGGGRSVGHAPRGPN 71 W FAT VS E V +H+ R V G A +GP+ Sbjct: 301390 WKAFATAVSREAVLEHIALCRKVADQVLASHRPRTGSA*QGPH 301262 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 58 GGGRSVGHAPRGPNIHGLPKGSL 80 G GRS +PRG G P+G L Sbjct: 230260 GDGRSQNRSPRGGRDRGAPQGVL 230192 >gb|GL349465.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.33, whole genome shotgun sequence Length = 407772 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 50 STTRIVPFGGGRSVGHAPR 68 ST R+VP GG S G +PR Sbjct: 186388 STCRLVPGAGGLSSGSSPR 186444 >gb|GL349458.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.26, whole genome shotgun sequence Length = 436025 Score = 25.0 bits (53), Expect = 7.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 58 GGGRSVGHAPRGPNIH 73 GGG GH PR P H Sbjct: 314411 GGGARSGHTPRPPTFH 314364 Score = 25.0 bits (53), Expect = 7.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 51 TTRIVPFGGGRSVGHAPRGPNIHGLPKGSLTGG 83 TT I P G RS G R G+P TGG Sbjct: 257452 TTTINPGGISRSAGQRTRPQRTGGVPVPGQTGG 257550 >gb|GL349455.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.23, whole genome shotgun sequence Length = 456395 Score = 25.0 bits (53), Expect = 7.8 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 56 PFGGGRSVGHAPR 68 P GGGR GHAPR Sbjct: 312331 PCGGGRFRGHAPR 312369 >gb|GL349451.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.19, whole genome shotgun sequence Length = 517691 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 54 IVPFGGGRSVGHAPRGPNIHGLPKGSLTGGC 84 ++P G GR G GP++H P+ + + GC Sbjct: 82293 LLPRGLGRHAGPV-HGPSLHSSPRQARSRGC 82204 >gb|GL349450.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.18, whole genome shotgun sequence Length = 527020 Score = 25.0 bits (53), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 49 RSTTRIVPFGGGRSVGHAPRGPN 71 R ++ P+G R+ HAPR P+ Sbjct: 258035 RGSSESAPYGTSRTSSHAPRRPS 258103 >gb|GL349449.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.17, whole genome shotgun sequence Length = 533784 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 67 PRGPNIHGLPKGSLTGGCAT 86 PRGP+ HGLP S AT Sbjct: 125113 PRGPSSHGLPSWSPPSTTAT 125054 >gb|GL349435.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.3, whole genome shotgun sequence Length = 673526 Score = 25.0 bits (53), Expect = 7.8 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +3 Query: 10 VDSKPFSLVDFFLSILRLMWLFFATLVSSEPVSQHVQEYRSTTRIVPFGG 59 + + P F L I R+ W+ +TLV P YR + I PF G Sbjct: 69468 ITTPPLMSSAFALLIFRMQWMQASTLVGELPEWM----YRLSRGIGPFNG 69605 Score = 25.0 bits (53), Expect = 7.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 61 RSVGHAPRGPNIHGLPKGSLTGGCAT 86 R++GHA R P G +G GCA+ Sbjct: 590228 RALGHACRTPCCDGACRGCCEDGCAS 590151 Database: T.trahens/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 28,680,627 Number of sequences in database: 131 Lambda K H 0.323 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,838,763 Number of Sequences: 131 Number of extensions: 60232 Number of successful extensions: 593 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 496 Number of HSP's gapped (non-prelim): 215 length of query: 89 length of database: 9,560,209 effective HSP length: 64 effective length of query: 25 effective length of database: 9,551,825 effective search space: 238795625 effective search space used: 238795625 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)