TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000016_1.0 # Protein # Selenoprotein K (SelK) # Homo
sapiens # Complete
         (94 letters)

Database: H.arabidopsidis/genome.fa 
           5422 sequences; 67,459,135 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|ABWE01000378.1| Hyaloperonospora parasitica strain Emoy2 v-7....    41   2e-04

>gb|ABWE01000378.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont29.9, whole genome
             shotgun sequence
          Length = 46228

 Score = 41.2 bits (95), Expect = 2e-04
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = -1

Query: 1     MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFF 38
             M Y++ G V+ +RS   WRLS+I D FWG+  FV L +
Sbjct: 40162 MTYVTEGNVVKTRSS--WRLSIIPDTFWGVLNFVGLLY 40055


  Database: H.arabidopsidis/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 67,459,135
  Number of sequences in database:  5422
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,870,673
Number of Sequences: 5422
Number of extensions: 45864
Number of successful extensions: 321
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 236
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 81
Number of HSP's gapped (non-prelim): 253
length of query: 94
length of database: 22,486,378
effective HSP length: 69
effective length of query: 25
effective length of database: 22,112,260
effective search space: 552806500
effective search space used: 552806500
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)