TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000016_1.0 # Protein # Selenoprotein K (SelK) # Homo
sapiens # Complete
         (94 letters)

Database: E.siliculosus/genome.fa 
           35 sequences; 195,934,119 total letters

Searching...................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

emb|FN649741.1| Ectocarpus siliculosus strain Ec 32, whole genom...    28   6.3  

>emb|FN649741.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence
               assembly, chromosome LG16
          Length = 8064047

 Score = 28.1 bits (61), Expect = 6.3
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +1

Query: 17      PWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYG 53
               PW + LI+       +F +LFF +++   V KR+S+G
Sbjct: 5944867 PWNVVLISQ------DFHILFFNSVVNTQVLKRQSFG 5944959


  Database: E.siliculosus/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 195,934,119
  Number of sequences in database:  35
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,498,885
Number of Sequences: 35
Number of extensions: 130496
Number of successful extensions: 797
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 784
Number of HSP's gapped (non-prelim): 50
length of query: 94
length of database: 65,311,373
effective HSP length: 69
effective length of query: 25
effective length of database: 65,308,958
effective search space: 1632723950
effective search space used: 1632723950
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)