TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000044_1.0 # Protein # Selenoprotein K1 (SelK1) # Drosophila melanogaster # Complete (110 letters) Database: E.siliculosus/genome.fa 35 sequences; 195,934,119 total letters Searching...................................done Score E Sequences producing significant alignments: (bits) Value emb|FN649755.1| Ectocarpus siliculosus strain Ec 32, whole genom... 28 4.8 >emb|FN649755.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG30 Length = 4005922 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 8 GRVWEKRPWDWRRIVELFVGIWFAIKQLFLTFLAPFTGNNN 48 G VW+ R W RR E +G W+ + + + +P + +NN Sbjct: 2730141 GTVWQGRTWGGRRWSEWRIGSWWGRRGGW*CWTSPRSHSNN 2730019 Database: E.siliculosus/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 195,934,119 Number of sequences in database: 35 Lambda K H 0.328 0.144 0.508 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,148,492 Number of Sequences: 35 Number of extensions: 246779 Number of successful extensions: 2582 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2563 Number of HSP's gapped (non-prelim): 51 length of query: 110 length of database: 65,311,373 effective HSP length: 85 effective length of query: 25 effective length of database: 65,308,398 effective search space: 1632709950 effective search space used: 1632709950 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 59 (27.3 bits)