TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000033_1.0 # Protein # Selenophosphate synthetase 2 (SPS2) # Homo sapiens # Complete (448 letters) Database: E.siliculosus/genome.fa 35 sequences; 195,934,119 total letters Searching...................................done Score E Sequences producing significant alignments: (bits) Value emb|FN649727.1| Ectocarpus siliculosus strain Ec 32, whole genom... 40 0.016 emb|FN649735.1| Ectocarpus siliculosus strain Ec 32, whole genom... 32 7.5 >emb|FN649727.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG02 Length = 9289656 Score = 40.4 bits (93), Expect = 0.016 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = -1 Query: 116 GIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAM 165 G+ + V P G V T DFF V DP++ G+IA + LSD++AM Sbjct: 3477516 GLDDAAVVAPPSEPGAVTVHTVDFFRSFVSDPFVFGQIAANHALSDVHAM 3477367 Score = 35.0 bits (79), Expect = 0.68 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 289 QEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGH 325 Q A+ +M N AA ++ A A TD+TGFG+ GH Sbjct: 3476047 QPAVRSMLQSNGPAATVLRDHGARACTDVTGFGVAGH 3475937 >emb|FN649735.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG10 Length = 4527641 Score = 31.6 bits (70), Expect = 7.5 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 61 GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSP 110 G ++P+ L G P P GR V +E++ EAG PSP Sbjct: 3966433 GSRLPRRCSTSSLPGANSPSGANPFGRAKVLSEEKSRSEAGANIRVSPSP 3966582 Database: E.siliculosus/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 195,934,119 Number of sequences in database: 35 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,073,625 Number of Sequences: 35 Number of extensions: 1705305 Number of successful extensions: 9342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9148 Number of HSP's gapped (non-prelim): 570 length of query: 448 length of database: 65,311,373 effective HSP length: 116 effective length of query: 332 effective length of database: 65,307,313 effective search space: 21682027916 effective search space used: 21682027916 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 69 (31.2 bits)