TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000016_1.0 # Protein # Selenoprotein K (SelK) # Homo
sapiens # Complete
         (94 letters)

Database: C.muris/genome.fa 
           84 sequences; 9,245,251 total letters

Searching...................................................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 geno...    25   2.5  
gb|DS989727.1| Cryptosporidium muris RN66 scf_1106632353999 geno...    25   3.3  

>gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 genomic scaffold, whole
              genome shotgun sequence
          Length = 965821

 Score = 25.0 bits (53), Expect = 2.5
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = -1

Query: 9      VLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRR 50
              +LD  S  P   ++I+   + ++ F V+FFK LL  D+  +R
Sbjct: 493858 ILDVCSNHPIVFAMISLTEFSVSLFSVIFFKELLILDLLAKR 493733


>gb|DS989727.1| Cryptosporidium muris RN66 scf_1106632353999 genomic scaffold, whole
              genome shotgun sequence
          Length = 1306717

 Score = 24.6 bits (52), Expect = 3.3
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +3

Query: 27     FWGIAEFVVLFFKTLLQ 43
              FWGIA  VV+ F T+L+
Sbjct: 609063 FWGIAS*VVIRFSTILR 609113


  Database: C.muris/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 9,245,251
  Number of sequences in database:  84
  
Lambda     K      H
   0.325    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 734,567
Number of Sequences: 84
Number of extensions: 8011
Number of successful extensions: 36
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 34
Number of HSP's gapped (non-prelim): 2
length of query: 94
length of database: 3,081,750
effective HSP length: 69
effective length of query: 25
effective length of database: 3,075,954
effective search space: 76898850
effective search space used: 76898850
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 48 (23.1 bits)