TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000056_1.0 # Protein # Selenophosphate synthetase 2 (SPS2) # Anopheles gambiae # Complete (369 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01005355.1| Ascogregarina taiwanensis CLECOP4A-H04.b1.032... 41 2e-04 gb|ABJQ01000536.1| Ascogregarina taiwanensis Contig648, whole ge... 26 8.5 >gb|ABJQ01005355.1| Ascogregarina taiwanensis CLECOP4A-H04.b1.032.ab1, whole genome shotgun sequence Length = 799 Score = 41.2 bits (95), Expect = 2e-04 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 236 ALESMSRLNKTGAELMKKYGAHAATDVTGFGLYGHAENL--ASHQTADVDF 284 A+E M+RLN G E G + TDVTGFG GH + S TA V+F Sbjct: 51 AIEIMTRLNNAGTEFATVPGVKSMTDVTGFGFLGHLIEMCDGSRVTARVNF 203 >gb|ABJQ01000536.1| Ascogregarina taiwanensis Contig648, whole genome shotgun sequence Length = 1276 Score = 25.8 bits (55), Expect = 8.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 160 ENPWCVIGGAASAVCHRSELIMPYNAQPGDALVL 193 EN W GA + VC EL P GDA +L Sbjct: 1072 EN*WSNERGARTDVCRAGELRTPARVYEGDAELL 971 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.319 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,383,637 Number of Sequences: 5379 Number of extensions: 32300 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of query: 369 length of database: 2,049,803 effective HSP length: 88 effective length of query: 281 effective length of database: 1,576,451 effective search space: 442982731 effective search space used: 442982731 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)