TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: T.trahens/genome.fa 131 sequences; 28,680,627 total letters Searching.................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL349470.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 60 1e-09 gb|GL349503.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 29 2.7 gb|GL349459.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 28 6.0 gb|GL349476.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 28 7.8 >gb|GL349470.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.38, whole genome shotgun sequence Length = 356648 Score = 60.1 bits (144), Expect = 1e-09 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 4/155 (2%) Frame = +2 Query: 98 HEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIG 157 H V V +C GY H+ + ++L + P ++ +G Y VG R +G Sbjct: 53639 HGVFVAFCQS*GYANHFRALRQALASAAPG------------VEVIGTNYPVGTLRAALG 53782 Query: 158 NIL--STGFLASIAI--SFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQS 213 ++ S A + + + +L +P + +V F+ NM+ S L + Sbjct: 53783 QMIMFSVPLFALVVVYANEICAWLDVPVPDALLYLASSKLMHIVVYYFVANMLVSQLTTT 53962 Query: 214 GAFEVYLNGSLIYSKLETGAVPTAETLADHILRQI 248 GAFE+Y++G L++SKL G P + D ++R + Sbjct: 53963 GAFELYVDGKLVFSKLTLGHAPAIDQAVDLVIRAL 54067 >gb|GL349503.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.71, whole genome shotgun sequence Length = 131184 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/79 (25%), Positives = 37/79 (46%) Frame = -1 Query: 65 HHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRS 124 HH+ +R + L KL++RE A V E + G+ ++ ++A R Sbjct: 79800 HHVVQRRTVRLGHRKLDERENENHNASRRLAVSREHK-------GHGHYHRKLAPHDRRL 79642 Query: 125 LPPELREQQKGKKPFIKFV 143 +PP L + + K+P ++ V Sbjct: 79641 VPPALVHKPRHKEPVLEHV 79585 >gb|GL349459.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.27, whole genome shotgun sequence Length = 436348 Score = 28.1 bits (61), Expect = 6.0 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 11/110 (10%) Frame = +3 Query: 43 KYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLE---KREEA--------LRKAR 91 ++LE + A + H EA +R + A +LE KREEA RKA Sbjct: 351132 EHLERRQAAHRSHLEHTIAEAEAAYELRRAELDAKTRLERARKREEAQALADAARYRKAT 351311 Query: 92 VTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIK 141 T HE R++ R+H E A R E R++ +G + ++ Sbjct: 351312 REATDAHEARLQAELADARRQHRAEAAALRRRIQHLESRQKHEGHEAEVR 351461 >gb|GL349476.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.44, whole genome shotgun sequence Length = 310991 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +2 Query: 48 LKEADLKQMLHEKGEAFHH-----LRSKRELILAVLKLEKREEALRKARV 92 ++ D + E GEA HH LRS+R ILA ++ K LR R+ Sbjct: 106910 VRRPDALITIGENGEAQHHVRVRKLRSRRRHILADVRHRKELARLRHGRI 107059 Database: T.trahens/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 28,680,627 Number of sequences in database: 131 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,183,377 Number of Sequences: 131 Number of extensions: 93608 Number of successful extensions: 499 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 490 Number of HSP's gapped (non-prelim): 36 length of query: 259 length of database: 9,560,209 effective HSP length: 97 effective length of query: 162 effective length of database: 9,547,502 effective search space: 1546695324 effective search space used: 1546695324 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits)