TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: P.tricornutum/genome.fa 31 sequences; 23,733,684 total letters Searching...............................done Score E Sequences producing significant alignments: (bits) Value gb|CM000619.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 51 7e-07 gb|CM000626.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 31 0.77 gb|CM000608.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 30 1.7 >gb|CM000619.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 17, whole genome shotgun sequence Length = 703943 Score = 50.8 bits (120), Expect = 7e-07 Identities = 54/188 (28%), Positives = 82/188 (43%), Gaps = 10/188 (5%) Frame = -3 Query: 82 KREEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIK 141 ++ + R + D QH V++ +C+G G +R++ V + L PELR Sbjct: 86778 RKSHSPRIKNMEDAAQH-VKILFCNG*GMKRNFLNV-QKFLEDQFPELRGH--------- 86632 Query: 142 FVGVVYSVGAFREFIGNILSTGFLASI--------AISFFAPFLRGALPPHIAEWIEQHR 193 G Y A E N++S L I I F + + LP + I Q+ Sbjct: 86631 ITGANYPPPATIELAANLMSVIQLMGIFWIVAGGEKIFRFLGYPQNQLPS-VYHTINQN- 86458 Query: 194 GMVVGAGFMMNMVA--SSLLQSGAFEVYLNGSLIYSKLETGAVPTAETLADHILRQIISG 251 M +G + + Q+GAFEVYLN I+SKL GA PTA+ L +++ Sbjct: 86457 AMPIGIFLFLILPQWIGRYTQTGAFEVYLNDKEIFSKLSKGAFPTADDLISSLVQ----- 86293 Query: 252 TAAGTRTA 259 AG +TA Sbjct: 86292 --AGLQTA 86275 >gb|CM000626.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 24, whole genome shotgun sequence Length = 511739 Score = 30.8 bits (68), Expect = 0.77 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +3 Query: 201 FMMNMVASSLLQSGAFEVYLNGSLIYSKLETGAVPTAETLADHILRQII 249 F N++ L S A +Y G+++ L+TGAVP AE+LA H + ++ Sbjct: 17928 FYSNLIPQVGLLSYAGNIY--GNIV---LDTGAVPNAESLAGHYAKALV 18059 >gb|CM000608.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 5, whole genome shotgun sequence Length = 1098047 Score = 29.6 bits (65), Expect = 1.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 67 LRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRRHY 114 L SKR+ +LE ++ +L+K H+ R +CS RR+Y Sbjct: 264763 LPSKRDFRRIHFRLETKQGSLKKRSSPSRTSHQKRRRFCSELDERRNY 264620 Database: P.tricornutum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 23,733,684 Number of sequences in database: 31 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,489,516 Number of Sequences: 31 Number of extensions: 71635 Number of successful extensions: 308 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 298 Number of HSP's gapped (non-prelim): 21 length of query: 259 length of database: 7,911,228 effective HSP length: 96 effective length of query: 163 effective length of database: 7,908,252 effective search space: 1289045076 effective search space used: 1289045076 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.9 bits)