TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL290984.1| Polysphondylium pallidum PN500 unplaced genomic s... 29 4.0 gb|GL290991.1| Polysphondylium pallidum PN500 unplaced genomic s... 28 8.9 >gb|GL290984.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold2, whole genome shotgun sequence Length = 3242543 Score = 28.9 bits (63), Expect = 4.0 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +3 Query: 31 DNEATDYSSHRYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKA 90 +N + +S++ + K + K+ + E R KRE++ A ++ EKRE++L K Sbjct: 402234 NNSISSSNSNKSNIRSINKSSTFKKCIDVDEE-----RRKREVVSASIRKEKREDSLAKK 402398 Query: 91 RVTDT 95 R T Sbjct: 402399 RSIQT 402413 >gb|GL290991.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold9, whole genome shotgun sequence Length = 2264991 Score = 27.7 bits (60), Expect = 8.9 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Frame = +2 Query: 151 AFREFIGNILSTGFLASIAISFFAPFLRGA--LPPHIAEWIEQHRGMVVGAGFMMNMVAS 208 +F+ F ++STGFLA + L GA P +A + G V GF ++++ Sbjct: 1915322 SFKVFYLVVVSTGFLADSLVDSLIVSLIGAGF*EPEVALF---GTGTTVTVGFGVSVLVE 1915492 Query: 209 SLLQSGAFEVYLNGS-LIYSKLETGAVPTAET 239 + S +NG+ ++ + +ETGA P +T Sbjct: 1915493 TFGSSDG----INGAGVVAAGVETGADPVVDT 1915576 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,826,649 Number of Sequences: 42 Number of extensions: 76969 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 277 Number of HSP's gapped (non-prelim): 16 length of query: 259 length of database: 10,980,844 effective HSP length: 98 effective length of query: 161 effective length of database: 10,976,728 effective search space: 1767253208 effective search space used: 1767253208 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)