TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: H.arabidopsidis/genome.fa 5422 sequences; 67,459,135 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABWE01000782.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 32 1.2 gb|ABWE01000178.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 32 1.2 gb|ABWE01000702.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 31 2.0 gb|ABWE01002071.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 30 4.5 >gb|ABWE01000782.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont280.1, whole genome shotgun sequence Length = 28059 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 97 QHEVRVEYCSGXGYRRHYEEVAESLLRS 124 Q + V YCSG +RRHY SLL S Sbjct: 8914 QCKCNVRYCSGSSHRRHYRSSKPSLLHS 8997 >gb|ABWE01000178.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont23.9, whole genome shotgun sequence Length = 65306 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 97 QHEVRVEYCSGXGYRRHYEEVAESLLRS 124 Q + V YCSG +RRHY SLL S Sbjct: 59460 QCKCNVRYCSGSSHRRHYRSSKPSLLHS 59543 >gb|ABWE01000702.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont176.6, whole genome shotgun sequence Length = 30782 Score = 30.8 bits (68), Expect = 2.0 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -3 Query: 180 ALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGA-FEVYLNGSLIYSKLETGAVPTAE 238 A+P H + HR +V+GAGF+ VA +L G L +L++ + GA Sbjct: 22746 AVPSHNGR-TDVHRVLVIGAGFLGCEVACALATDGRNHPDRLQTTLVFVEHAPGARTLPR 22570 Query: 239 TLADHILRQII 249 LAD + R+++ Sbjct: 22569 YLADDLARRLV 22537 >gb|ABWE01002071.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont778.1, whole genome shotgun sequence Length = 6013 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 159 ILSTGFLASIAISFFAPFLRGALPPH 184 +LS FLA IA F P ++ +LPPH Sbjct: 5707 VLSDAFLAVIAYIKFGPNIKASLPPH 5784 Database: H.arabidopsidis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 67,459,135 Number of sequences in database: 5422 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,176,052 Number of Sequences: 5422 Number of extensions: 188058 Number of successful extensions: 829 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 39 Number of HSP's that attempted gapping in prelim test: 533 Number of HSP's gapped (non-prelim): 372 length of query: 259 length of database: 22,486,378 effective HSP length: 103 effective length of query: 156 effective length of database: 21,927,912 effective search space: 3420754272 effective search space used: 3420754272 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 62 (28.5 bits)