TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01003295.1| Ascogregarina taiwanensis Contig3630, whole g... 31 0.16 gb|ABJQ01003051.1| Ascogregarina taiwanensis Contig3384, whole g... 28 1.4 gb|ABJQ01002516.1| Ascogregarina taiwanensis Contig2823, whole g... 27 2.4 gb|ABJQ01004101.1| Ascogregarina taiwanensis CLRanP80-C01.g1.ab1... 27 3.1 gb|ABJQ01004723.1| Ascogregarina taiwanensis CLRanP102-C01.g1.ab... 25 6.9 gb|ABJQ01002460.1| Ascogregarina taiwanensis Contig2766, whole g... 25 6.9 gb|ABJQ01002266.1| Ascogregarina taiwanensis Contig2561, whole g... 25 6.9 gb|ABJQ01002629.1| Ascogregarina taiwanensis Contig2937, whole g... 25 9.0 gb|ABJQ01001800.1| Ascogregarina taiwanensis Contig2043, whole g... 25 9.0 >gb|ABJQ01003295.1| Ascogregarina taiwanensis Contig3630, whole genome shotgun sequence Length = 2401 Score = 30.8 bits (68), Expect = 0.16 Identities = 20/76 (26%), Positives = 30/76 (39%) Frame = +1 Query: 176 FLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFEVYLNGSLIYSKLETGAVP 235 FLR L PHI ++ H G L Q+ + E+ +G + Y ++ V Sbjct: 2089 FLRNGLDPHILPFLGNHAG------------RPDLRQNPSIELDSSGVIFYGNVDAHCVQ 2232 Query: 236 TAETLADHILRQIISG 251 AD +LR G Sbjct: 2233 KTHRFADVLLRPFPGG 2280 >gb|ABJQ01003051.1| Ascogregarina taiwanensis Contig3384, whole genome shotgun sequence Length = 3737 Score = 27.7 bits (60), Expect = 1.4 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 8/88 (9%) Frame = -2 Query: 64 FHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRR-------HYEE 116 FHHLRS R + +L+ +E R R + H ++E + +RR H + Sbjct: 1429 FHHLRS*RVAVWLFRQLQLHQEIKRHHRCRRQLNHSTQMERRALCLHRRRRRPKLQHRPQ 1250 Query: 117 VAESLLRSLPPELREQQKGKK-PFIKFV 143 L P R +Q KK IKFV Sbjct: 1249 YQGRYLIERPQRQRTKQGPKKGQPIKFV 1166 >gb|ABJQ01002516.1| Ascogregarina taiwanensis Contig2823, whole genome shotgun sequence Length = 1824 Score = 26.9 bits (58), Expect = 2.4 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 40 HRYKYLEMLKEADLKQMLHEKGEAFHHLR 68 +R +YL++L AD+K+ + + + H+R Sbjct: 591 YRQRYLDLLVNADVKRTFNIRSQVIRHIR 677 >gb|ABJQ01004101.1| Ascogregarina taiwanensis CLRanP80-C01.g1.ab1, whole genome shotgun sequence Length = 826 Score = 26.6 bits (57), Expect = 3.1 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Frame = -2 Query: 82 KREEALRKARVTD--TVQHEVRVEYCS-----GXGYRRHYEEVAESLLRSLPP 127 K+ L K+R+ H + Y S G HYEE +E+L R PP Sbjct: 321 KKHSPLEKSRLAGHRLANHRICCRYVSLPNRIAQGSAFHYEEKSETLQRRFPP 163 >gb|ABJQ01004723.1| Ascogregarina taiwanensis CLRanP102-C01.g1.ab1, whole genome shotgun sequence Length = 890 Score = 25.4 bits (54), Expect = 6.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 139 FIKFVGVVYSVGAFREFIGNILSTGFLASIAISFFAPFLRGALPP 183 F + GVV +GA +F GNI + + A+ FA F GA P Sbjct: 606 FAEAFGVVALIGASPDFPGNIERSFSVLRAALDGFASF--GAFDP 478 >gb|ABJQ01002460.1| Ascogregarina taiwanensis Contig2766, whole genome shotgun sequence Length = 1106 Score = 25.4 bits (54), Expect = 6.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 170 ISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFM 202 ++F+ G +P H W+E+H V+G M Sbjct: 108 LTFWCQIFVGPVPVHRRLWLEEHELTVLGRRLM 206 >gb|ABJQ01002266.1| Ascogregarina taiwanensis Contig2561, whole genome shotgun sequence Length = 1890 Score = 25.4 bits (54), Expect = 6.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 146 VYSVGAFREFIGNILSTGFLASIAISF 172 +YS G F++ +GNIL F +I I F Sbjct: 1798 IYSQGNFQKCLGNILCGLFSTAIIIPF 1878 >gb|ABJQ01002629.1| Ascogregarina taiwanensis Contig2937, whole genome shotgun sequence Length = 1902 Score = 25.0 bits (53), Expect = 9.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 119 ESLLRSLPPELREQQKGKKP 138 E LL SLPP ++ Q KKP Sbjct: 747 EELLESLPPPVQSQPLWKKP 806 >gb|ABJQ01001800.1| Ascogregarina taiwanensis Contig2043, whole genome shotgun sequence Length = 1641 Score = 25.0 bits (53), Expect = 9.0 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 Query: 166 ASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMM 203 AS A F A FLR PPH A W + G + G ++ Sbjct: 1033 ASPATDFLAHFLRRFFPPHSA-WEAEVTGYSLVEGLIL 923 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,410,562 Number of Sequences: 5379 Number of extensions: 17278 Number of successful extensions: 92 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of query: 259 length of database: 2,049,803 effective HSP length: 85 effective length of query: 174 effective length of database: 1,592,588 effective search space: 277110312 effective search space used: 277110312 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)