TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelQ_toxoplasma_gondii_gladyshev # QUERY (66 letters) Database: P.ultimum/genome.fa 82 sequences; 42,801,618 total letters Searching.................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL376603.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 31 0.16 gb|GL376636.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 29 0.80 gb|GL376631.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 28 1.4 gb|GL376617.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 28 1.4 gb|GL376638.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 27 3.1 gb|GL376619.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 27 3.1 gb|GL376628.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 27 4.0 gb|GL376604.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 26 5.2 gb|GL376560.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 26 5.2 gb|GL376620.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 26 6.8 gb|GL376585.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 26 6.8 gb|GL376567.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 26 6.8 gb|GL376592.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 25 8.9 >gb|GL376603.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582006, whole genome shotgun sequence Length = 1270039 Score = 31.2 bits (69), Expect = 0.16 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +2 Query: 20 RERGIQPEHRRTWQFR---GTIPQNPHLAPRFRPNVNDRYQIRR-GRGG 64 RER + RR Q R G + HLA RP V+ R+Q+RR GRGG Sbjct: 464507 RERPQRHVGRRALQDRAR*GQDVRRRHLAVEARPGVDPRHQVRRCGRGG 464653 >gb|GL376636.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582039, whole genome shotgun sequence Length = 1829366 Score = 28.9 bits (63), Expect = 0.80 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +3 Query: 18 ADRERGIQPEHRRTWQFRGTIPQNPHLA---------PRFRPNVNDRYQIRRG 61 A++ QP+HRR Q R + Q PH A P R +V+ + +RG Sbjct: 98727 AEKTHARQPQHRRDTQAREEVQQQPHNAQHQVLGVARPDIRAHVHTEDRDKRG 98885 Score = 25.4 bits (54), Expect = 8.9 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 23 GIQPEHRRTWQ-FRGTIPQNPHLAPRFRPNVNDRYQIRRGRGGXC 66 G +P HR RGT P++ PR R R + R R G C Sbjct: 185474 GSRPRHRGAASGARGTAPRSA*RRPRPRARARPRPRPRAPRAGTC 185340 >gb|GL376631.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582034, whole genome shotgun sequence Length = 1169325 Score = 28.1 bits (61), Expect = 1.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 26 PEHRRTWQFRGTIPQNPHLAPR 47 P RTW +R T P++PH A R Sbjct: 1028789 PRSPRTWPWRTTTPRHPHCALR 1028854 >gb|GL376617.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582020, whole genome shotgun sequence Length = 790859 Score = 28.1 bits (61), Expect = 1.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 20 RERGIQPEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIR 59 R R +P + +W R T + PH RFRP+ R ++R Sbjct: 613334 RRRRTRPRSKSSWSLRRTTLK-PHQRVRFRPSEPPRARVR 613450 >gb|GL376638.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582041, whole genome shotgun sequence Length = 1261388 Score = 26.9 bits (58), Expect = 3.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 17 AADRERGIQPEHRRTWQFRGTIPQNPHLAPR 47 A +R RG+ P R ++R P +PHL R Sbjct: 658290 AHERPRGVAPTRRAPRRYRQRGPADPHLQTR 658382 >gb|GL376619.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582022, whole genome shotgun sequence Length = 784545 Score = 26.9 bits (58), Expect = 3.1 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +2 Query: 22 RGIQPEHRR--TWQFRGTIPQNPHLAPRFRPNVND 54 R P RR T RGT P+ P +APR RP+ D Sbjct: 674372 RARAPWRRRP*TRSSRGTAPRWPRVAPRARPHPPD 674476 Score = 25.8 bits (55), Expect = 6.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 26 PEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIRRGR 62 P H RGT+PQ HL R +R + R+GR Sbjct: 307417 PAHAPRSANRGTVPQTQHLP---RETCKERKRTRQGR 307518 >gb|GL376628.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582031, whole genome shotgun sequence Length = 1316296 Score = 26.6 bits (57), Expect = 4.0 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Frame = +2 Query: 17 AADRERGIQPEHRR--TWQFRGTI---PQNPHLAP 46 A D ++ + EHRR T + G I P NPHL P Sbjct: 1216466 ALDAQQQLNSEHRRLATVELHGLIGLEPSNPHLEP 1216570 >gb|GL376604.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582007, whole genome shotgun sequence Length = 931704 Score = 26.2 bits (56), Expect = 5.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 30 RTWQFRGTIPQNPHLAPRFRPNVNDRYQIR 59 R W I Q P LAPR RP +R Sbjct: 215748 RPWPRPDMIVQRPQLAPRLRPPTRSHQTLR 215659 Score = 25.4 bits (54), Expect = 8.9 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -3 Query: 22 RGIQPEHRRTWQFRGTIPQ----NPHLAPRFRPNVNDRYQIR 59 R + RR + R +P NP APR P+ +DR Q+R Sbjct: 880168 RADRSARRRGRRDRRAVPHGGRANPRAAPRCDPSGHDRAQVR 880043 >gb|GL376560.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581242, whole genome shotgun sequence Length = 870537 Score = 26.2 bits (56), Expect = 5.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 24 IQPEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIRRGRGGXC 66 + P HR+ +IP P + FRP+ Y RRGR C Sbjct: 836351 LHPCHRQCRNAPCSIPSRPLCSTWFRPSTQRPY--RRGRRSSC 836473 >gb|GL376620.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582023, whole genome shotgun sequence Length = 1683196 Score = 25.8 bits (55), Expect = 6.8 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 19 DRERGIQPEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIR 59 DR+R + +RTW+F H A FR YQ+R Sbjct: 1375646 DRDRSLPESFKRTWEF-----YLLHSAACFRAQALQVYQVR 1375539 Score = 25.4 bits (54), Expect = 8.9 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = -2 Query: 20 RERGIQPEHRRTWQFRGTIPQNPHLAPRFRPNV--------NDRYQIRRGRGGXC 66 R I P H W+ T H + RFRP + + RRGR C Sbjct: 727743 RTARILPAHGERWRDGSTNTGRGHTSARFRPGAAALRSGSWSRAWSCRRGRHDGC 727579 >gb|GL376585.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581789, whole genome shotgun sequence Length = 837833 Score = 25.8 bits (55), Expect = 6.8 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 22 RGIQPEHRRTWQFRGTIPQNPHLAPRF 48 RG +PE TW R ++P P F Sbjct: 639165 RGDRPERLTTWSVRSSLPSGSAADPNF 639085 >gb|GL376567.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581354, whole genome shotgun sequence Length = 1199448 Score = 25.8 bits (55), Expect = 6.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 38 IPQNPHLAPRFRPN 51 IP+NP +PRF+PN Sbjct: 994885 IPRNPKHSPRFKPN 994844 Score = 25.4 bits (54), Expect = 8.9 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 19 DRERGIQPEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIRR 60 DR+R PEHRR ++P++ R R R Q RR Sbjct: 651501 DRDRRYSPEHRRD----RSMPRSSRADERSRGRSRSRSQTRR 651388 >gb|GL376592.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581880, whole genome shotgun sequence Length = 568974 Score = 25.4 bits (54), Expect = 8.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 21 ERGIQPEHRRTWQFRGTIPQNPHLA 45 ERG++ EHRR Q +P+ H A Sbjct: 435380 ERGLKREHRRHKQLHQKLPRRRHHA 435306 Database: P.ultimum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 42,801,618 Number of sequences in database: 82 Lambda K H 0.326 0.143 0.484 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,334,035 Number of Sequences: 82 Number of extensions: 42676 Number of successful extensions: 439 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 407 Number of HSP's gapped (non-prelim): 96 length of query: 66 length of database: 14,267,206 effective HSP length: 41 effective length of query: 25 effective length of database: 14,263,844 effective search space: 356596100 effective search space used: 356596100 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (25.4 bits)