TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelQ_toxoplasma_gondii_gladyshev # QUERY (66 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL291010.1| Polysphondylium pallidum PN500 unplaced genomic s... 25 8.9 gb|GL290991.1| Polysphondylium pallidum PN500 unplaced genomic s... 25 8.9 >gb|GL291010.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_contig13, whole genome shotgun sequence Length = 836226 Score = 25.0 bits (53), Expect = 8.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -2 Query: 25 QPEHRRTWQFRGTIPQNPHLAPRFRPNVNDRYQIRRGRGG 64 QP+ ++ Q + P+N + PR + N + Q+ G G Sbjct: 780680 QPQQQQQQQRQHRQPRNNNYQPRNQQQSNQQQQVNAGNAG 780561 >gb|GL290991.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold9, whole genome shotgun sequence Length = 2264991 Score = 25.0 bits (53), Expect = 8.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 28 HRRTWQFRGTIPQNPHLAPRFRPNVN 53 HR TW F + P + + R RP ++ Sbjct: 505541 HRNTWHFVSSCPLSKPVRNRHRPTIS 505618 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.326 0.143 0.484 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,542,455 Number of Sequences: 42 Number of extensions: 13790 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 81 Number of HSP's gapped (non-prelim): 4 length of query: 66 length of database: 10,980,844 effective HSP length: 41 effective length of query: 25 effective length of database: 10,979,122 effective search space: 274478050 effective search space used: 274478050 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)