TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000114_1.0 # Protein # Selenoprotein N (SelN) # Mus musculus # Complete (557 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL290998.1| Polysphondylium pallidum PN500 unplaced genomic s... 34 0.35 gb|GL290990.1| Polysphondylium pallidum PN500 unplaced genomic s... 29 8.5 >gb|GL290998.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_contig1, whole genome shotgun sequence Length = 1301413 Score = 33.9 bits (76), Expect = 0.35 Identities = 21/84 (25%), Positives = 38/84 (45%) Frame = +1 Query: 414 HSILLWGALDDQSCUGSGRTLRETVLESPPILTLLNESFISTWSLVKELEDLQTQQENPL 473 +S L+W L + S + + S P+ + L +S S WSL + + Q Q NP+ Sbjct: 247459 NSCLVWPVLPTSTLKTSKSWISLPTMHSRPL*SRLVKS--SVWSLKRRSQSFQCQSTNPV 247632 Query: 474 HRQLAGLHLEKYSFPVEMMICLPN 497 L +H + + M + +P+ Sbjct: 247633 SLSLHSIHSMVHPISMPMSLSVPS 247704 >gb|GL290990.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold8, whole genome shotgun sequence Length = 2270872 Score = 29.3 bits (64), Expect = 8.5 Identities = 33/147 (22%), Positives = 57/147 (38%), Gaps = 1/147 (0%) Frame = -2 Query: 31 ALLGALLAAAAAVAAARACALLADAQAAARQESALKVLGTDGLFLFSSLDTDQDMYISPE 90 A GA AAA++ + A AC ++ + + LF + +D +SP Sbjct: 685764 AFFGAAAAAASSFSLAAACCCASNMEP---------------MDLFLGFEIGKDESLSPN 685630 Query: 91 EFKPIAEKLTGSVPVANYEEEELPHDPSEETLTIEARFQPLLMETMTKSKDGFLGVSRLA 150 + + G + +A + ++P SE L A F T GF + LA Sbjct: 685629 KPPELFASSRGDLFLAAPKPNDIPSSKSESFLA--AGFSTGFSATTVGFTTGFSATAGLA 685456 Query: 151 LS-GLRNWTTAASPSAAFAARHFRPFL 176 S G N ++ S F+++ + L Sbjct: 685455 ASTGTSNISSLLSLVVGFSSKSLKKSL 685375 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.320 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,829,863 Number of Sequences: 42 Number of extensions: 284280 Number of successful extensions: 1249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1238 Number of HSP's gapped (non-prelim): 104 length of query: 557 length of database: 10,980,844 effective HSP length: 106 effective length of query: 451 effective length of database: 10,976,392 effective search space: 4950352792 effective search space used: 4950352792 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 64 (29.3 bits)