TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000114_1.0 # Protein # Selenoprotein N (SelN) # Mus
musculus # Complete
         (557 letters)

Database: N.gruberi/genome.fa 
           784 sequences; 40,964,085 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|GG738849.1| Naegleria gruberi genomic scaffold NAEGRscaffold_...    33   0.73 

>gb|GG738849.1| Naegleria gruberi genomic scaffold NAEGRscaffold_5, whole genome shotgun
              sequence
          Length = 850158

 Score = 33.1 bits (74), Expect = 0.73
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 5/65 (7%)
 Frame = -1

Query: 465    LQTQQENPLHRQLAGLHLEKY----SFPVEMMICLPNGTVVHHINANYFL-DITSMKPED 519
              L  Q  + L+  L  LH+        FP+++ I LPN  ++  +  NYFL  + S+K + 
Sbjct: 808413 LNVQMLHELNEHLQYLHMIHVI*HMPFPIKLPIILPNQLILQKVVHNYFLIFVQSLKRQP 808234

Query: 520    MENNN 524
              +E+N+
Sbjct: 808233 LEHNH 808219


  Database: N.gruberi/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 40,964,085
  Number of sequences in database:  784
  
Lambda     K      H
   0.320    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,832,239
Number of Sequences: 784
Number of extensions: 397916
Number of successful extensions: 1582
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 44
Number of HSP's successfully gapped in prelim test: 30
Number of HSP's that attempted gapping in prelim test: 1331
Number of HSP's gapped (non-prelim): 595
length of query: 557
length of database: 13,654,695
effective HSP length: 107
effective length of query: 450
effective length of database: 13,570,807
effective search space: 6106863150
effective search space used: 6106863150
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)