TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000114_1.0 # Protein # Selenoprotein N (SelN) # Mus musculus # Complete (557 letters) Database: C.muris/genome.fa 84 sequences; 9,245,251 total letters Searching...................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|DS989768.1| Cryptosporidium muris RN66 scf_1106632373447 geno... 30 1.4 gb|DS989735.1| Cryptosporidium muris RN66 scf_1106632353989 geno... 28 7.1 >gb|DS989768.1| Cryptosporidium muris RN66 scf_1106632373447 genomic scaffold, whole genome shotgun sequence Length = 1421 Score = 30.0 bits (66), Expect = 1.4 Identities = 29/87 (33%), Positives = 36/87 (41%), Gaps = 16/87 (18%) Frame = +1 Query: 2 GQARPAARRPHSPDPGAQPAPPRRRARALALLGALLA------AAAAVAAARACALLAD- 54 G AR ARR P +P P R R + LG L+A A A A+ CA LA Sbjct: 181 GAARRRARRASRPAVALRPRPRRCRTQRERHLGKLVARQDRRRARARTVASGRCARLAAG 360 Query: 55 ---------AQAAARQESALKVLGTDG 72 +A+AR S V+ DG Sbjct: 361 PEDRLLRRVGRASARDLSWHAVVSKDG 441 >gb|DS989735.1| Cryptosporidium muris RN66 scf_1106632353989 genomic scaffold, whole genome shotgun sequence Length = 378465 Score = 27.7 bits (60), Expect = 7.1 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 2/116 (1%) Frame = +1 Query: 410 KKLVHSILLWGALDDQSCUGSGRTLRETVLESPPILTLLNESFISTWSLVKELEDLQTQQ 469 KKL LL+ +D+ + ++ L+SP +LT+ ++FI + +KEL Sbjct: 306595 KKLKVDPLLYNKIDNITL------IKNNSLDSP-LLTIYQDNFIKIYGQIKELILYNLIN 306753 Query: 470 ENPLHRQLAGLHLEKYSFPVEMMICLPNGTVVHH--INANYFLDITSMKPEDMENN 523 +N L + +S + M GT++ N +F+ I S+K + M N+ Sbjct: 306754 QNENFSTLDTVSKWLWSDSIGFMY---TGTILESDISNKEFFVKIYSVKIDIMNNS 306912 Database: C.muris/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 9,245,251 Number of sequences in database: 84 Lambda K H 0.320 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,863,400 Number of Sequences: 84 Number of extensions: 69203 Number of successful extensions: 258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 239 Number of HSP's gapped (non-prelim): 71 length of query: 557 length of database: 3,081,750 effective HSP length: 97 effective length of query: 460 effective length of database: 3,073,602 effective search space: 1413856920 effective search space used: 1413856920 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (27.3 bits)