TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000018_1.0 # Protein # Selenoprotein N (SelN) # Homo sapiens # Complete (590 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL290998.1| Polysphondylium pallidum PN500 unplaced genomic s... 33 0.64 gb|GL291006.1| Polysphondylium pallidum PN500 unplaced genomic s... 31 3.2 gb|GL290984.1| Polysphondylium pallidum PN500 unplaced genomic s... 30 4.1 gb|GL290990.1| Polysphondylium pallidum PN500 unplaced genomic s... 30 5.4 gb|GL290986.1| Polysphondylium pallidum PN500 unplaced genomic s... 30 7.0 gb|GL290983.1| Polysphondylium pallidum PN500 unplaced genomic s... 29 9.2 >gb|GL290998.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_contig1, whole genome shotgun sequence Length = 1301413 Score = 33.1 bits (74), Expect = 0.64 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 3 RARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAA 42 +A P PP P PAA+PP PR +A + A A AA Sbjct: 608013 KAAPVSAPPPPPPPAARPPTAPRAQAPAPASANAAALPAA 608132 >gb|GL291006.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_contig9, whole genome shotgun sequence Length = 1029409 Score = 30.8 bits (68), Expect = 3.2 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 6/72 (8%) Frame = -1 Query: 470 ETVLESSPILTLLN-ESFISTWSLVKELEELQ--NNQENSSHQKLAGLHL---EKYSFPV 523 ET + + T+ N +F + S VK +L N+ EN+ +++ G H+ ++ P+ Sbjct: 29587 ETFFRINEVSTVANIPTFYTPLSDVKNNYQLVRINSNENTFEEEVCGNHIALNKRIPSPI 29408 Query: 524 EMMICLPNGTVV 535 E++ C P TVV Sbjct: 29407 EILFCTPQTTVV 29372 >gb|GL290984.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold2, whole genome shotgun sequence Length = 3242543 Score = 30.4 bits (67), Expect = 4.1 Identities = 28/113 (24%), Positives = 43/113 (38%), Gaps = 3/113 (2%) Frame = -2 Query: 60 RQELALKTLGTDGLFLFSS---LDTDGDMYISPEEFKPIAEKLTGSCSVTQTGVQWCSHS 116 R E + + DG + S LD GD Y+ E + I +K ++TQ V + + Sbjct: 363988 RVEKKIHEIDIDGKQAYVSVYKLDASGDFYLGVIEERLIKKKKI--LTITQEHVNDLTRA 363815 Query: 117 SLQPQLPWLNUSSCLSLLRSTPAASCEEEELPPDPSEETLTIEARFQPLLPET 169 +P + + TP++ PP PS T T P P T Sbjct: 363814 GFKPS----KFDLLFNKISITPSSPSTSTSTPPTPSSPTSTTTTPSTPSSPTT 363668 Score = 29.6 bits (65), Expect = 7.0 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +1 Query: 343 MEWLYG-------ASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEP 395 + WL+G S S++ G P L PS S++L+ + SH G P Sbjct: 1824571 LSWLFGNVSTRQHTSNDSSVCSKQGLPPTALLSLLSPSTASILLNR--CIF*SHANPGSP 1824744 Query: 396 LQFVFEEIKW 405 L + EI W Sbjct: 1824745 LSMIRSEIAW 1824774 >gb|GL290990.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold8, whole genome shotgun sequence Length = 2270872 Score = 30.0 bits (66), Expect = 5.4 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = -3 Query: 17 AAQPPAP---PRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAARQELA 64 A QPPAP P A A + A +AAA AAAV A A A + +A Sbjct: 2260727 ALQPPAPMTPPVAAAPVAAAVAAAVAAAVAAAVAAAVAAAVAAAVGAEPVA 2260575 >gb|GL290986.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold4, whole genome shotgun sequence Length = 1229170 Score = 29.6 bits (65), Expect = 7.0 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = +2 Query: 6 PGQRG-PPSPGPAAQPPAP 23 PGQ G PP+PG QPPAP Sbjct: 905861 PGQYGQPPAPGQYGQPPAP 905917 Score = 29.3 bits (64), Expect = 9.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 554 IESNLFSFSSTFEDPSTATYMQFLKEGLRR 583 +E+N+ SFS ++ + AT FLK GL+R Sbjct: 771195 VETNMISFSLP*KESTVATVGSFLKSGLKR 771106 >gb|GL290983.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold1, whole genome shotgun sequence Length = 1995969 Score = 29.3 bits (64), Expect = 9.2 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +2 Query: 284 FYYTVMFRIHAEFQLSEPPDFPFWFSPAQFTGHIIL----SKDATHVRDFRLFVPNH 336 F YT +F +H+E L P F F+FS F H L ++ T + R+F+PN+ Sbjct: 1531640 FNYTFLFYLHSENSLLNDPFFFFFFSMYCFFLHQRLF*LNHQNNTII*LRRMFLPNY 1531810 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.318 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,787,616 Number of Sequences: 42 Number of extensions: 323347 Number of successful extensions: 2009 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 1868 Number of HSP's gapped (non-prelim): 461 length of query: 590 length of database: 10,980,844 effective HSP length: 106 effective length of query: 484 effective length of database: 10,976,392 effective search space: 5312573728 effective search space used: 5312573728 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)