TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000018_1.0 # Protein # Selenoprotein N (SelN) # Homo sapiens # Complete (590 letters) Database: C.parvum/genome.fa 8 sequences; 9,102,324 total letters Searching........done Score E Sequences producing significant alignments: (bits) Value gb|CM000431.1| Cryptosporidium parvum Iowa II chromosome 3, whol... 32 0.52 gb|CM000434.1| Cryptosporidium parvum Iowa II chromosome 6, whol... 29 3.4 gb|CM000432.1| Cryptosporidium parvum Iowa II chromosome 4, whol... 28 5.8 gb|CM000436.1| Cryptosporidium parvum Iowa II chromosome 8, whol... 28 7.5 >gb|CM000431.1| Cryptosporidium parvum Iowa II chromosome 3, whole genome shotgun sequence Length = 1099352 Score = 31.6 bits (70), Expect = 0.52 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = -2 Query: 472 VLESSPILTLLNESFISTWSLVKELEELQNNQENS 506 +L + P TLL SF WS EL QNN++NS Sbjct: 681067 ILSNKPSPTLLIRSFALRWSSTFELAYYQNNKKNS 680963 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/76 (19%), Positives = 34/76 (44%) Frame = -1 Query: 510 KLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPS 569 ++ GL L K FP +M+C+ ++ ++++K + +NL +F F S Sbjct: 432899 EIKGLTLSKLKFPFGLMVCIKRLSI----------KVSTLK*LHVNTNLNTFLEIFSSNS 432750 Query: 570 TATYMQFLKEGLRRGL 585 ++ + + + L Sbjct: 432749 VKFFLILFSDSVSKSL 432702 >gb|CM000434.1| Cryptosporidium parvum Iowa II chromosome 6, whole genome shotgun sequence Length = 1332857 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = +2 Query: 192 TAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSMFTGYLSNNRFYPPPP 245 +A P V AT PF +GE + P S GY FYPPPP Sbjct: 1052015 SAGPRPPGVQATPQTSPFA------MGENPYSYPYSSSPGGGYYYYYNFYPPPP 1052158 >gb|CM000432.1| Cryptosporidium parvum Iowa II chromosome 4, whole genome shotgun sequence Length = 1104417 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 20 PPAPPRRRARSLALLG--ALLAAAAAAAVRVCA 50 PP PP++R R + AL AAAAAAA A Sbjct: 397983 PPEPPKKRGRGRPRINREALAAAAAAAAANNAA 398081 >gb|CM000436.1| Cryptosporidium parvum Iowa II chromosome 8, whole genome shotgun sequence Length = 1344712 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 132 SLLRSTPAASCEEEELPPDPSEETLTIEA 160 SLL S P C+ +LPPD + +T+++ Sbjct: 700929 SLLSSPPLLPCDPAKLPPDAAATLVTLDS 701015 Database: C.parvum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 9,102,324 Number of sequences in database: 8 Lambda K H 0.318 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,562,391 Number of Sequences: 8 Number of extensions: 85479 Number of successful extensions: 659 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 615 Number of HSP's gapped (non-prelim): 126 length of query: 590 length of database: 3,034,108 effective HSP length: 97 effective length of query: 493 effective length of database: 3,033,332 effective search space: 1495432676 effective search space used: 1495432676 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (27.3 bits)