TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: S.parasitica/genome.fa 1445 sequences; 53,132,636 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gb|GG743961.1| Saprolegnia parasitica CBS 223.65 genomic scaffol... 31 3.6 gb|GG744022.1| Saprolegnia parasitica CBS 223.65 genomic scaffol... 31 4.7 gb|GG743931.1| Saprolegnia parasitica CBS 223.65 genomic scaffol... 30 6.1 gb|GG743917.1| Saprolegnia parasitica CBS 223.65 genomic scaffol... 30 8.0 >gb|GG743961.1| Saprolegnia parasitica CBS 223.65 genomic scaffold supercont1.79, whole genome shotgun sequence Length = 180961 Score = 31.2 bits (69), Expect = 3.6 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 163 ISSSTFYASQFKVFLPPSGKSAVGDTWWIIPSELNIFTGYLPNNRFH 209 ++SS ++++LPP V DTWW I +F R H Sbjct: 169462 LASSHLRQLLYRIWLPPLAPYLVVDTWWAIARRAAVFRQPASRTRLH 169322 >gb|GG744022.1| Saprolegnia parasitica CBS 223.65 genomic scaffold supercont1.140, whole genome shotgun sequence Length = 131932 Score = 30.8 bits (68), Expect = 4.7 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 2 ATDVDKTPAGEQKDDHEDRGTPSSR-RGRSR 31 AT++D PA Q DDH R PSS RGR R Sbjct: 81775 ATELDAEPACVQHDDHARRPAPSSADRGRRR 81867 >gb|GG743931.1| Saprolegnia parasitica CBS 223.65 genomic scaffold supercont1.49, whole genome shotgun sequence Length = 259822 Score = 30.4 bits (67), Expect = 6.1 Identities = 29/97 (29%), Positives = 41/97 (42%), Gaps = 14/97 (14%) Frame = +1 Query: 104 VAPPPEYEEEIPHDPNGETLTL--HAKMQPLLLESMTKSKDGFL------------GVSH 149 VAPPP ++ P E +++ AK PL + M S+ L Sbjct: 190015 VAPPPTSKKLAGEPPKSEMMSIVAMAKPAPLTRQPMLPSRPM*LRSYAEASTSRGSSCVL 190194 Query: 150 SSLSGLRSWKRPAISSSTFYASQFKVFLPPSGKSAVG 186 S L+ + W+ A+SS ASQ + PSG SA G Sbjct: 190195 SRLAKMSLWRNDALSSKLILASQ--AYTLPSGVSANG 190299 >gb|GG743917.1| Saprolegnia parasitica CBS 223.65 genomic scaffold supercont1.35, whole genome shotgun sequence Length = 346584 Score = 30.0 bits (66), Expect = 8.0 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -1 Query: 204 PNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQGAVAC 245 P++R +PP PR + +L HS++ PR ++R GA +C Sbjct: 269424 PSSRPYPPRPRPRFLLKHSVVEAHQPRVGARAR----GASSC 269311 Database: S.parasitica/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 53,132,636 Number of sequences in database: 1445 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,737,115 Number of Sequences: 1445 Number of extensions: 633951 Number of successful extensions: 3219 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 56 Number of HSP's that attempted gapping in prelim test: 2430 Number of HSP's gapped (non-prelim): 1458 length of query: 557 length of database: 17,710,878 effective HSP length: 109 effective length of query: 448 effective length of database: 17,553,373 effective search space: 7863911104 effective search space used: 7863911104 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 65 (29.6 bits)