TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: P.ultimum/genome.fa 82 sequences; 42,801,618 total letters Searching.................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL376590.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 36 0.12 gb|GL376620.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 30 5.0 gb|GL376585.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 30 6.5 >gb|GL376590.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581868, whole genome shotgun sequence Length = 538251 Score = 35.8 bits (81), Expect = 0.12 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = +1 Query: 271 DFPFWFTPGQF---AGHIILSKDASHVRDFHIYVPNDKTLNVDMEWLYGASETSNMEVDI 327 D P W T G F AG ++++ +S +FHIY+ + + L AS +S + Sbjct: 51262 DVPKWITDGGFSLLAGESVVAQSSSSKLEFHIYIKSVAAEFFTVPSLSDASSSSGAFYIL 51441 Query: 328 GYLPQ-MELGAEGPSTPSVIYDEQGNMIDSRGEGGEPIQF 366 G P +E G S+ S + G + S EP F Sbjct: 51442 GAYPSPLEYFLHGASSSSFEINNSGEL--SLSSSAEPFDF 51555 >gb|GL376620.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875582023, whole genome shotgun sequence Length = 1683196 Score = 30.4 bits (67), Expect = 5.0 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +3 Query: 75 LFFFSSLDTDHDLYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNGETLTLHAKMQPLLL 134 +FF + L+ DH L L P E + I + G P P +P L++ Q L+ Sbjct: 1049046 VFFLARLEVDHPLVLGPREPQEIGDDFAGKVQPIPCFLARPAEPRPRLLSIERGAQERLV 1049225 >gb|GL376585.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581789, whole genome shotgun sequence Length = 837833 Score = 30.0 bits (66), Expect = 6.5 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 140 SKDGFLGVSHSSLSGLRSWKRPAISSSTFYASQFKVFLPPS 180 SKDGF+ VS + GLRSW + FY Q +F S Sbjct: 682971 SKDGFVSVSFLKMVGLRSWG----TRVRFYTQQQLIFTASS 683081 Database: P.ultimum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 42,801,618 Number of sequences in database: 82 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,129,225 Number of Sequences: 82 Number of extensions: 478453 Number of successful extensions: 2291 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 2213 Number of HSP's gapped (non-prelim): 192 length of query: 557 length of database: 14,267,206 effective HSP length: 107 effective length of query: 450 effective length of database: 14,258,432 effective search space: 6416294400 effective search space used: 6416294400 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)