TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein
N [Danio rerio]
         (557 letters)

Database: P.tricornutum/genome.fa 
           31 sequences; 23,733,684 total letters

Searching...............................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|CM000616.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ...    29   6.2  

>gb|CM000616.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 14, whole genome
             shotgun sequence
          Length = 829358

 Score = 29.3 bits (64), Expect = 6.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = -1

Query: 155   LRSWKRPAISSSTFYASQFKVFLPPSGKSAVGDTWWIIPSEL 196
             LR+W+R   S  T        FLPP G+      W +I ++L
Sbjct: 91046 LRTWRRSLSSPVTIPPILCSCFLPPCGRRTFTTLWILISTQL 90921


  Database: P.tricornutum/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 23,733,684
  Number of sequences in database:  31
  
Lambda     K      H
   0.318    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,412,525
Number of Sequences: 31
Number of extensions: 278920
Number of successful extensions: 1317
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1287
Number of HSP's gapped (non-prelim): 110
length of query: 557
length of database: 7,911,228
effective HSP length: 103
effective length of query: 454
effective length of database: 7,908,035
effective search space: 3590247890
effective search space used: 3590247890
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)