TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL290996.1| Polysphondylium pallidum PN500 unplaced genomic s... 31 2.9 gb|GL290983.1| Polysphondylium pallidum PN500 unplaced genomic s... 29 8.5 >gb|GL290996.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold14, whole genome shotgun sequence Length = 1054919 Score = 30.8 bits (68), Expect = 2.9 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 7/103 (6%) Frame = +2 Query: 40 IIAAIPVISFCIKYYLDIQFVKRHEAGLKALGADGLFFFSSLDTDHDLYLSPEEFKPIAE 99 + A+IPV S +KY L + + A L A+ + + D LY+S + Sbjct: 882506 LTASIPVFSIIVKYNLLQTKLPKFGAILLAIFLPWIIVIPFMTGDRLLYISNYASLFFSS 882685 Query: 100 KLTGVAPPPEYEEEIPHDPNGETLTLHAK-------MQPLLLE 135 + P Y + + NG T+T H K + P+LLE Sbjct: 882686 ASNFIIPLLIYLKSVQFRKNGRTMTDHQKQILKEAGIDPILLE 882814 >gb|GL290983.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold1, whole genome shotgun sequence Length = 1995969 Score = 29.3 bits (64), Expect = 8.5 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -1 Query: 87 LYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNGETLTLHAKMQPLLLESMTKSKD 142 L +SP + K +AE TG + E H NG+TLT+ + Q + + S D Sbjct: 1462827 LSISPNK-KKLAEDATGTREKIDIVESRTHQVNGKTLTIKSTKQKIDSSDSSDSSD 1462663 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,986,807 Number of Sequences: 42 Number of extensions: 307152 Number of successful extensions: 1202 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1184 Number of HSP's gapped (non-prelim): 73 length of query: 557 length of database: 10,980,844 effective HSP length: 106 effective length of query: 451 effective length of database: 10,976,392 effective search space: 4950352792 effective search space used: 4950352792 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)