TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: H.arabidopsidis/genome.fa 5422 sequences; 67,459,135 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABWE01000871.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 31 4.4 gb|ABWE01000126.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 31 5.8 gb|ABWE01000379.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 30 9.9 >gb|ABWE01000871.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont94.13, whole genome shotgun sequence Length = 25246 Score = 31.2 bits (69), Expect = 4.4 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 8/44 (18%) Frame = +1 Query: 137 MTKSKDGFLGVS--------HSSLSGLRSWKRPAISSSTFYASQ 172 M KS++GF S HS+ +G+R W++P S ST YAS+ Sbjct: 13366 MIKSQNGFARASLSPL*PESHSNNAGIRGWRKP--SRSTVYASR 13491 >gb|ABWE01000126.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont96.1, whole genome shotgun sequence Length = 74061 Score = 30.8 bits (68), Expect = 5.8 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = -3 Query: 24 SSRRGRSRFTQISSLFIIAAIPVISFCIKYYLDIQFVKRHEAGLKALGADGLFFFSS 80 + R G S + I F +A + + + Y+L ++ + + +G DGLF SS Sbjct: 61765 ADRYGGSYYIHIHLAFSVAGVSAVLLSVYYHLQLERTDQRRCPSQFVGRDGLFLKSS 61595 >gb|ABWE01000379.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont36.3, whole genome shotgun sequence Length = 46217 Score = 30.0 bits (66), Expect = 9.9 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 440 VLESSPVLALLNQSFISSWSLVKELEDLQGDVKNLELSEKARLHLEK 486 +L SP++ L N SF+ WS ++ DLQ V + EKAR EK Sbjct: 20220 MLACSPLIFLKNSSFMPKWSDDQDPLDLQFFVPQQKDLEKARTVSEK 20360 Database: H.arabidopsidis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 67,459,135 Number of sequences in database: 5422 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,974,205 Number of Sequences: 5422 Number of extensions: 696020 Number of successful extensions: 2861 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 166 Number of HSP's that attempted gapping in prelim test: 2438 Number of HSP's gapped (non-prelim): 844 length of query: 557 length of database: 22,486,378 effective HSP length: 110 effective length of query: 447 effective length of database: 21,889,958 effective search space: 9784811226 effective search space used: 9784811226 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 66 (30.0 bits)