TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: E.siliculosus/genome.fa 35 sequences; 195,934,119 total letters Searching...................................done Score E Sequences producing significant alignments: (bits) Value emb|FN649760.1| Ectocarpus siliculosus strain Ec 32, whole genom... 34 2.0 emb|FN649728.1| Ectocarpus siliculosus strain Ec 32, whole genom... 32 7.6 emb|FN649751.1| Ectocarpus siliculosus strain Ec 32, whole genom... 32 7.6 emb|FN649755.1| Ectocarpus siliculosus strain Ec 32, whole genom... 32 10.0 >emb|FN649760.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, unassigned sequences LGUn Length = 58155991 Score = 33.9 bits (76), Expect = 2.0 Identities = 15/60 (25%), Positives = 31/60 (51%) Frame = +2 Query: 352 NMIDSRGEGGEPIQFVFEEIVWSEELKREEASRRLEVTMYPFKKVPYLPFSEAFSRASAE 411 N++ + G+GG+ ++ VW ++ R++ T + + P+LPF+ FS S + Sbjct: 5329046 NLLSTEGQGGDVVR------VWQARVEGANIGHRVQSTKFHVTRRPFLPFAVLFSPVSTK 5329207 >emb|FN649728.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG03 Length = 7313625 Score = 32.0 bits (71), Expect = 7.6 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = -3 Query: 155 LRSWKRPAISSSTFYASQFKVFLPPSGKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPR 214 L W+RP SS+ A+ + + P+ + VG W P R PPTPR Sbjct: 1698787 LPRWRRPRFPSSS-PAAPAPLSISPAAVATVGGDW--------------PRPRRQPPTPR 1698653 Query: 215 GKE 217 G+E Sbjct: 1698652 GRE 1698644 >emb|FN649751.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG26 Length = 7107661 Score = 32.0 bits (71), Expect = 7.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 275 WFTPGQFAGHIILSKDASHVRDFHI 299 WF PG FAGH + SH + HI Sbjct: 5364169 WFQPGTFAGHAVALLSGSHHKTIHI 5364243 Score = 31.6 bits (70), Expect = 10.0 Identities = 19/70 (27%), Positives = 29/70 (41%) Frame = -2 Query: 315 YGASETSNMEVDIGYLPQMELGAEGPSTPSVIYDEQGNMIDSRGEGGEPIQFVFEEIVWS 374 + ++ N G LP L GP++P + GN I +RG E ++ S Sbjct: 6541824 FTTTDACNFTFSDGQLPNFRLPEAGPNSPGDVQLNLGNNIITRGWVEEDESESISTLLES 6541645 Query: 375 EELKREEASR 384 +KRE R Sbjct: 6541644 RRIKRERKQR 6541615 >emb|FN649755.1| Ectocarpus siliculosus strain Ec 32, whole genome shotgun sequence assembly, chromosome LG30 Length = 4005922 Score = 31.6 bits (70), Expect = 10.0 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -3 Query: 427 QSCUGSGRTLRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNLELSEKARLH 483 Q C R+ R+ V + ++ ++++ F SWS+ EDL K+L ++A LH Sbjct: 1496027 QKCHEGCRSSRKYVRATKRIIFMISEGF--SWSVCGPAEDLLPQQKSLRTDDEASLH 1495863 Database: E.siliculosus/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 195,934,119 Number of sequences in database: 35 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 153,475,570 Number of Sequences: 35 Number of extensions: 2948774 Number of successful extensions: 14027 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 13512 Number of HSP's gapped (non-prelim): 2838 length of query: 557 length of database: 65,311,373 effective HSP length: 118 effective length of query: 439 effective length of database: 65,307,243 effective search space: 28669879677 effective search space used: 28669879677 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 70 (31.6 bits)