TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: C.muris/genome.fa 84 sequences; 9,245,251 total letters Searching...................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|DS989730.1| Cryptosporidium muris RN66 scf_1106632373475 geno... 30 1.9 gb|DS989732.1| Cryptosporidium muris RN66 scf_1106632373461 geno... 29 2.4 gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 geno... 28 5.4 >gb|DS989730.1| Cryptosporidium muris RN66 scf_1106632373475 genomic scaffold, whole genome shotgun sequence Length = 723783 Score = 29.6 bits (65), Expect = 1.9 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 9/99 (9%) Frame = -3 Query: 96 PIAEKLTG-------VAPPPEYE-EEIPHDPNGETLTLHAKMQPLLLESMTKSKDGFLGV 147 PIA+KL G ++ P +Y EEIP+DPN + L L S ++ + G+ Sbjct: 458908 PIADKLIGEDKSNTTLSIPSKYMCEEIPNDPN------ELRSFTLSLVSEYRTLWNYTGI 458747 Query: 148 SHSSLSGLRSWKRPAISS-STFYASQFKVFLPPSGKSAV 185 + S RS +R + Y F V P+ +S V Sbjct: 458746 LYESYQSRRSMQRKYLEQIRDLYGCDFHVAYIPTLQSEV 458630 >gb|DS989732.1| Cryptosporidium muris RN66 scf_1106632373461 genomic scaffold, whole genome shotgun sequence Length = 567910 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 456 SSWSLVKELEDLQGDVKNLELSEKARLHLEKYTFPVQMM 494 S++S+V DL ++ +L + H+EKY+F V ++ Sbjct: 372306 SAFSVVSHCVDLNANISTAQLESLVQEHIEKYSFLVPLV 372422 >gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 genomic scaffold, whole genome shotgun sequence Length = 965821 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -1 Query: 383 SRRLEVTMYPFKKVPYLPFSEAFSRASAEKKLVHSIL 419 S +L + + +P L FSEA SRA+ E++ SI+ Sbjct: 540010 SNKLTPPIIQYSHIPALNFSEATSRATIEEEQAESIV 539900 Database: C.muris/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 9,245,251 Number of sequences in database: 84 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,362,954 Number of Sequences: 84 Number of extensions: 80675 Number of successful extensions: 335 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 287 Number of HSP's gapped (non-prelim): 109 length of query: 557 length of database: 3,081,750 effective HSP length: 97 effective length of query: 460 effective length of database: 3,073,602 effective search space: 1413856920 effective search space used: 1413856920 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (27.3 bits)