TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: C.merolae/genome.fa 20 sequences; 16,546,747 total letters Searching....................done Score E Sequences producing significant alignments: (bits) Value dbj|AP006499.2| Cyanidioschyzon merolae DNA, chromosome 17, comp... 35 0.10 dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, comp... 29 4.3 dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, comp... 28 7.4 dbj|AP006486.2| Cyanidioschyzon merolae DNA, chromosome 4, compl... 28 9.7 dbj|AP006491.2| Cyanidioschyzon merolae DNA, chromosome 9, compl... 28 9.7 dbj|AP006497.2| Cyanidioschyzon merolae DNA, chromosome 15, comp... 28 9.7 >dbj|AP006499.2| Cyanidioschyzon merolae DNA, chromosome 17, complete genome, complete sequence Length = 1232258 Score = 34.7 bits (78), Expect = 0.10 Identities = 40/131 (30%), Positives = 53/131 (40%), Gaps = 20/131 (15%) Frame = -2 Query: 152 LSGLRSWKRPAISSSTFYASQFKVFLPPS----GKSA----VGDTWWIIPSELNIFTGYL 203 L + SW R I FYA+ FKVF + +SA +GD W PS +L Sbjct: 393544 LGVVASWSR-IIGQQRFYAAPFKVFRHLAKMHCAQSACTLCMGDEWHHFPSSF-----FL 393383 Query: 204 PNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQGA------------VACIRATSD 251 P N T R + SLL P+PFV + P+G VA I D Sbjct: 393382 PGNT----TLRFVRMNASSLL----PKPFVSTNIVPEGMNDRNAPVYDDRFVASIAEECD 393227 Query: 252 FYYDIVFRIHA 262 F+ +V + A Sbjct: 393226 FFAGLVNDVKA 393194 >dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, complete genome, complete sequence Length = 852727 Score = 29.3 bits (64), Expect = 4.3 Identities = 20/71 (28%), Positives = 31/71 (43%) Frame = -1 Query: 436 LRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNLELSEKARLHLEKYTFPVQMMV 495 LR T VL + S V+E+E L + + + R+HLE+YT PV + Sbjct: 454669 LRATCTRHRSVLKVCRTGMRGSVPSVREIETLLSQLPWRQF-QSPRVHLEQYTTPVHLA- 454496 Query: 496 VLPNGTVVHHI 506 + HH+ Sbjct: 454495 ----ARIAHHV 454475 >dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence Length = 1621617 Score = 28.5 bits (62), Expect = 7.4 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 8/107 (7%) Frame = -1 Query: 121 ETLTLHAKMQP-----LLLE---SMTKSKDGFLGVSHSSLSGLRSWKRPAISSSTFYASQ 172 E T H+ + P ++LE S+ + GFLG + SS G + + + + TF+ Sbjct: 756942 EKRTTHSTVMPACNSSIVLE*IASIGEGMAGFLG-NGSSRRGSANVREQQVRTDTFFRKV 756766 Query: 173 FKVFLPPSGKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPRGKEVL 219 +V + PSG + D + + + +P N RG+ +L Sbjct: 756765 VQVCVVPSGSDGLVDARYAVVA--------IPTNTIAVSV*RGRHIL 756649 >dbj|AP006486.2| Cyanidioschyzon merolae DNA, chromosome 4, complete genome, complete sequence Length = 513455 Score = 28.1 bits (61), Expect = 9.7 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 4/83 (4%) Frame = +1 Query: 216 KEVLIHSLLSMFHPRPFVKSRFAPQGAVACIRATSDFYYDIV----FRIHAEFQLNDVPD 271 K L+HS + + H + +R PQG V+ + + + R HA QL + Sbjct: 63559 KCTLLHSRVDLHHVMFPMSTRQVPQGLVSVVNNSRGVDPSTLALCTARSHA--QLEVIAA 63732 Query: 272 FPFWFTPGQFAGHIILSKDASHV 294 P + PG F+ + DA HV Sbjct: 63733 LPAFLVPGSFSMLEAKTADAGHV 63801 >dbj|AP006491.2| Cyanidioschyzon merolae DNA, chromosome 9, complete genome, complete sequence Length = 810151 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 525 GLSFSAGFEDPSTSTYIRFLQEGLEKAKPYL 555 GL SAG DPSTS + + KA P L Sbjct: 45478 GLEISAGMVDPSTSASCKAMTHSPSKANPAL 45386 >dbj|AP006497.2| Cyanidioschyzon merolae DNA, chromosome 15, complete genome, complete sequence Length = 902900 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -3 Query: 236 RFAPQGAVACIRATSDFYYDIVF---RIHAEFQLNDVPDFPFWFTPGQFAGHIIL 287 RF G A A D + F FQ+ P FW P QF+G +++ Sbjct: 403452 RFLVSGVGAYGGAVEDLIESVAFINPSFDTSFQVLRFPTVAFWCQPSQFSGSLLI 403288 Database: C.merolae/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 16,546,747 Number of sequences in database: 20 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,315,193 Number of Sequences: 20 Number of extensions: 186837 Number of successful extensions: 858 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 821 Number of HSP's gapped (non-prelim): 229 length of query: 557 length of database: 5,515,582 effective HSP length: 101 effective length of query: 456 effective length of database: 5,513,562 effective search space: 2514184272 effective search space used: 2514184272 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 61 (28.1 bits)