TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP12000018_1.0 gi|287325231|ref|NP_001004294.4| selenoprotein N [Danio rerio] (557 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01001477.1| Ascogregarina taiwanensis Contig1690, whole g... 28 2.8 gb|ABJQ01002470.1| Ascogregarina taiwanensis Contig2776, whole g... 28 3.6 gb|ABJQ01002844.1| Ascogregarina taiwanensis Contig3165, whole g... 27 8.1 >gb|ABJQ01001477.1| Ascogregarina taiwanensis Contig1690, whole genome shotgun sequence Length = 368 Score = 28.1 bits (61), Expect = 2.8 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = -3 Query: 293 HVRDFHIYVPNDKTLNVDMEWLYGASETSNMEVDIGYLPQMELGAEGPSTPS 344 HVRD HI + + +E++ T NME IG L M+ G E TP+ Sbjct: 147 HVRDTHIGL----VASAQLEFVL-LLHTDNMESPIGVLRMMKGGEESTRTPN 7 >gb|ABJQ01002470.1| Ascogregarina taiwanensis Contig2776, whole genome shotgun sequence Length = 2219 Score = 27.7 bits (60), Expect = 3.6 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 11/75 (14%) Frame = -2 Query: 272 FPFWFTPGQFAGHIILSKDAS-----------HVRDFHIYVPNDKTLNVDMEWLYGASET 320 +PF TPGQ A ++L AS H + IY P D V WLY Sbjct: 1903 YPFLMTPGQSAAVLLLMPAASSSVSNSLPPDGHFANLCIYKPRDHA--VMPCWLYHFQWC 1730 Query: 321 SNMEVDIGYLPQMEL 335 + G+ P ++L Sbjct: 1729 QRLLRPAGFDPHIQL 1685 >gb|ABJQ01002844.1| Ascogregarina taiwanensis Contig3165, whole genome shotgun sequence Length = 2533 Score = 26.6 bits (57), Expect = 8.1 Identities = 19/89 (21%), Positives = 37/89 (41%), Gaps = 4/89 (4%) Frame = -2 Query: 382 ASRRLEVTMYPFKKVPYLPFSEAFSRASAEKKLVHSILLWGALDDQSCUGSG----RTLR 437 A ++++VT KVP+ + S +++ ++++W +G RT R Sbjct: 2049 ARQQIQVTPNHVMKVPWRVVMQRLIACSHRRRVSSALVIWTNSSSSCAAAAGCLA*RTGR 1870 Query: 438 ETVLESSPVLALLNQSFISSWSLVKELED 466 L P+ L+ SW ++ L D Sbjct: 1869 RPTLW*CPLWKFLSHLLCLSWPRIRCLVD 1783 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.318 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,259,146 Number of Sequences: 5379 Number of extensions: 70169 Number of successful extensions: 307 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of query: 557 length of database: 2,049,803 effective HSP length: 92 effective length of query: 465 effective length of database: 1,554,935 effective search space: 723044775 effective search space used: 723044775 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)