TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP11000018_1.0 # gi|298231231|ref|NP_001177172.1| selenoprotein N, 1 [Ciona intestinalis] (580 letters) Database: T.trahens/genome.fa 131 sequences; 28,680,627 total letters Searching.................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL349443.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 31 2.1 gb|GL349449.1| Thecamonas trahens ATCC 50062 unplaced genomic sc... 29 7.8 >gb|GL349443.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.11, whole genome shotgun sequence Length = 571036 Score = 31.2 bits (69), Expect = 2.1 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 10/60 (16%) Frame = +2 Query: 441 RASVENKLIHQVVLWGALDDQSCXGSGRTLRETALESSPVI----------QLLNQSFIS 490 RAS + Q +LWGALDD + G RE L SP + LL+Q +IS Sbjct: 171485 RASGNCRT*AQGLLWGALDDAARHGGRLPHREAGLRRSPAVPAERRAILMGPLLHQHYIS 171664 >gb|GL349449.1| Thecamonas trahens ATCC 50062 unplaced genomic scaffold supercont1.17, whole genome shotgun sequence Length = 533784 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 468 RTLRETALESSPVIQLLNQSFISTWSLLKDLEVISNDKQSPLSNVANL 515 RT T +P Q F +T SLLK ++SN+K S L ++ L Sbjct: 368170 RTTASTPTARTPTSTAR*QPFFATTSLLKPDTILSNEKHSSLPGLSAL 368027 Database: T.trahens/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 28,680,627 Number of sequences in database: 131 Lambda K H 0.317 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,524,040 Number of Sequences: 131 Number of extensions: 239302 Number of successful extensions: 944 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 912 Number of HSP's gapped (non-prelim): 98 length of query: 580 length of database: 9,560,209 effective HSP length: 105 effective length of query: 475 effective length of database: 9,546,454 effective search space: 4534565650 effective search space used: 4534565650 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 63 (28.9 bits)