TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP11000018_1.0 # gi|298231231|ref|NP_001177172.1| selenoprotein N, 1 [Ciona intestinalis] (580 letters) Database: P.ultimum/genome.fa 82 sequences; 42,801,618 total letters Searching.................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|GL376564.1| Pythium ultimum DAOM BR144 unplaced genomic scaff... 30 8.9 >gb|GL376564.1| Pythium ultimum DAOM BR144 unplaced genomic scaffold scf_1117875581313, whole genome shotgun sequence Length = 1115623 Score = 29.6 bits (65), Expect = 8.9 Identities = 26/102 (25%), Positives = 37/102 (36%), Gaps = 16/102 (15%) Frame = -3 Query: 151 KADMIPLVLSSMSQTNKNPAF----------------GTPLFHYSKDFSGLVAWKSVKTE 194 + D+ L+ SSM+ T +P PL H S L+ + + Sbjct: 678041 RGDVFSLLRSSMALTWSDPLLKIATDVAQGVTYLHNCDPPLVHRDLKSSNLLCTPTYSCK 677862 Query: 195 QKDLYAKEFKAFLPNNSSQLVGEPYWLIQRPNNPEELTSNRY 236 D + + N S +VG PYWL PE L RY Sbjct: 677861 LSDFGESKRQTVTGNLFSTIVGTPYWLA-----PEILREERY 677751 Database: P.ultimum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 42,801,618 Number of sequences in database: 82 Lambda K H 0.317 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,535,008 Number of Sequences: 82 Number of extensions: 329957 Number of successful extensions: 1559 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1543 Number of HSP's gapped (non-prelim): 133 length of query: 580 length of database: 14,267,206 effective HSP length: 108 effective length of query: 472 effective length of database: 14,258,350 effective search space: 6729941200 effective search space used: 6729941200 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 65 (29.6 bits)