TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP11000018_1.0 # gi|298231231|ref|NP_001177172.1| selenoprotein N, 1 [Ciona intestinalis] (580 letters) Database: H.arabidopsidis/genome.fa 5422 sequences; 67,459,135 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABWE01000089.1| Hyaloperonospora parasitica strain Emoy2 v-7.... 37 0.11 >gb|ABWE01000089.1| Hyaloperonospora parasitica strain Emoy2 v-7.0.1_Cont53.10, whole genome shotgun sequence Length = 85241 Score = 36.6 bits (83), Expect = 0.11 Identities = 27/83 (32%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +1 Query: 225 PNNPEELTSNRYRYPIPKTKIEKLLHNLLVMFHPRPFVTMRFSPQGAAAVIR---AQNQV 281 P EEL ++R RYP T LL L + + + Q AAA+ R Sbjct: 9694 PVRAEELPADRKRYPTLNTAEASLLLGLFEQVYVKSRGSFSDRKQMAAAITRELFTTKWA 9873 Query: 282 YLEIVFRFHSEFQLNEPPYLPYW 304 + EIV RF S+ + PP L W Sbjct: 9874 FKEIVRRFASKHKWAHPPVLSQW 9942 Database: H.arabidopsidis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 67,459,135 Number of sequences in database: 5422 Lambda K H 0.317 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,458,673 Number of Sequences: 5422 Number of extensions: 514826 Number of successful extensions: 2259 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 80 Number of HSP's that attempted gapping in prelim test: 1955 Number of HSP's gapped (non-prelim): 524 length of query: 580 length of database: 22,486,378 effective HSP length: 111 effective length of query: 469 effective length of database: 21,884,536 effective search space: 10263847384 effective search space used: 10263847384 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 66 (30.0 bits)