TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000009_1.0 # Protein # Glutathione peroxidase 6 (GPx6) # Homo sapiens # Complete (221 letters) Database: C.owczarzaki/genome.fa 89 sequences; 28,043,798 total letters Searching........................................................................................done Score E Sequences producing significant alignments: (bits) Value supercontig_1.15 of Capsaspora owczarzaki ATCC 30864 32 0.24 supercontig_1.14 of Capsaspora owczarzaki ATCC 30864 28 4.5 >supercontig_1.15 of Capsaspora owczarzaki ATCC 30864 Length = 930169 Score = 32.3 bits (72), Expect = 0.24 Identities = 29/104 (27%), Positives = 41/104 (39%), Gaps = 36/104 (34%) Frame = -3 Query: 77 AQYPELNALQEELKNFGVIVLAFPCNQF-------------------------------- 104 + Y EL + ELK+ G ++AFPC QF Sbjct: 29018 SNYTELQQIYSELKDKGFEIIAFPCAQFLNVSVDTARVLHHRPLA*TLILIFTLFFFFFF 28839 Query: 105 ----GKQEPGTNSEILLGLKYVCPGSGFVPSFQLFEKGDVNGEK 144 +QEP T ++IL K + F +FQL EK VNG++ Sbjct: 28838 FFCNQQQEPETGAKILDFGK-----TRFGVTFQLMEKTKVNGQE 28722 >supercontig_1.14 of Capsaspora owczarzaki ATCC 30864 Length = 919646 Score = 28.1 bits (61), Expect = 4.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 120 KYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTS 160 KY+ P V F + + E+ +F F+KN PPTS Sbjct: 745265 KYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVKNVLPPTS 745387 Database: C.owczarzaki/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 28,043,798 Number of sequences in database: 89 Lambda K H 0.322 0.139 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,382,131 Number of Sequences: 89 Number of extensions: 103935 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 373 Number of HSP's gapped (non-prelim): 24 length of query: 221 length of database: 9,347,932 effective HSP length: 95 effective length of query: 126 effective length of database: 9,339,477 effective search space: 1176774102 effective search space used: 1176774102 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.9 bits)