TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000009_1.0 # Protein # Glutathione peroxidase 6 (GPx6) # Homo sapiens # Complete (221 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01002697.1| Ascogregarina taiwanensis Contig3010, whole g... 29 0.50 gb|ABJQ01002709.1| Ascogregarina taiwanensis Contig3023, whole g... 25 5.5 gb|ABJQ01003169.1| Ascogregarina taiwanensis Contig3503, whole g... 25 7.2 gb|ABJQ01004502.1| Ascogregarina taiwanensis CLRanP155-G09.b1.ab... 25 9.4 >gb|ABJQ01002697.1| Ascogregarina taiwanensis Contig3010, whole genome shotgun sequence Length = 1665 Score = 28.9 bits (63), Expect = 0.50 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 126 SGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMK 175 S FVP+ E+ KV+ LKN T L GS++Q W P++ Sbjct: 681 SSFVPT---------TNEQNLKVWDILKNELKVTCSLRGSAAQEKWPPLQ 803 >gb|ABJQ01002709.1| Ascogregarina taiwanensis Contig3023, whole genome shotgun sequence Length = 1841 Score = 25.4 bits (54), Expect = 5.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 152 LKNSCPPTSDLLGSSSQLFWEPMKV 176 LK S PP + GSS L WE + V Sbjct: 1325 LKLSIPPNLRIPGSSCMLLWEALGV 1399 >gb|ABJQ01003169.1| Ascogregarina taiwanensis Contig3503, whole genome shotgun sequence Length = 2213 Score = 25.0 bits (53), Expect = 7.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 155 SCPPTSDLLGSSSQL 169 +CPP S LLGS S L Sbjct: 2034 ACPPNSSLLGSMSSL 1990 >gb|ABJQ01004502.1| Ascogregarina taiwanensis CLRanP155-G09.b1.ab1, whole genome shotgun sequence Length = 780 Score = 24.6 bits (52), Expect = 9.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 152 LKNSCPPTSDLLGSSSQLFWEPMKVHD 178 L N CP D L +S W+ ++HD Sbjct: 681 LLNQCPGRCDFLSTSLDGTWKIWRLHD 761 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.322 0.139 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,627,808 Number of Sequences: 5379 Number of extensions: 22219 Number of successful extensions: 79 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of query: 221 length of database: 2,049,803 effective HSP length: 83 effective length of query: 138 effective length of database: 1,603,346 effective search space: 221261748 effective search space used: 221261748 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)