TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000007_1.0 # Protein # Glutathione peroxidase 4 (GPx4) # Homo sapiens # Complete (197 letters) Database: C.merolae/genome.fa 20 sequences; 16,546,747 total letters Searching....................done Score E Sequences producing significant alignments: (bits) Value dbj|AP006498.2| Cyanidioschyzon merolae DNA, chromosome 16, comp... 30 0.46 dbj|AP006485.2| Cyanidioschyzon merolae DNA, chromosome 3, compl... 29 1.3 dbj|AP006484.2| Cyanidioschyzon merolae DNA, chromosome 2, compl... 28 2.3 dbj|AP006495.2| Cyanidioschyzon merolae DNA, chromosome 13, comp... 28 3.0 dbj|AP006492.2| Cyanidioschyzon merolae DNA, chromosome 10, comp... 27 6.6 dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, comp... 27 6.6 dbj|AP006486.2| Cyanidioschyzon merolae DNA, chromosome 4, compl... 26 8.6 dbj|AP006494.2| Cyanidioschyzon merolae DNA, chromosome 12, comp... 26 8.6 dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, comp... 26 8.6 >dbj|AP006498.2| Cyanidioschyzon merolae DNA, chromosome 16, complete genome, complete sequence Length = 908485 Score = 30.4 bits (67), Expect = 0.46 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 16 CGALAAPGLAGTMCASRDDWRC---ARSMHEFSAKDIDGHMVNLD-KYRGFVCI 65 CG A P L +C SR WR AR + KD+ ++V + + G +CI Sbjct: 889291 CGDQAQPRLVARVCLSRRRWRAFHFARGPTQLGTKDLVRNLVKVQGRQSGALCI 889452 Score = 26.6 bits (57), Expect = 6.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 20 AAPGLAGTMCASRDDWRCARSMHEF 44 AAP L G +C+ R CA+S+H F Sbjct: 47637 AAPLLRGAVCSLRACAPCAQSVHSF 47711 >dbj|AP006485.2| Cyanidioschyzon merolae DNA, chromosome 3, complete genome, complete sequence Length = 481791 Score = 28.9 bits (63), Expect = 1.3 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -3 Query: 151 PKGKGILGNAIKWN--FTKFLIDKNGCVVKRYGPMEEPLVIEKDL 193 P+ G+LG A + + L ++GC V RY P++EP EKD+ Sbjct: 328930 PRIVGVLGAAGQMGSGIAEVLGQRSGCTVLRYDPVKEP---EKDI 328805 >dbj|AP006484.2| Cyanidioschyzon merolae DNA, chromosome 2, complete genome, complete sequence Length = 457013 Score = 28.1 bits (61), Expect = 2.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 1 MSLGRLCRLLKPALLCGALAAPGLAGTMCASR 32 + LGR+CR + AL G LA+ G C R Sbjct: 454963 VGLGRICRKRRRALCSGTLASTGATDLRCNPR 455058 Score = 26.6 bits (57), Expect = 6.6 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = -3 Query: 87 HARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKW 146 HAR A C R A P N + + + K+ N F K + +AH LW++ Sbjct: 391422 HARTARCSSRAYAAPRNGEERNKLRLDSRTKDRCLLENKDASRFKKPTPS*GNAHCLWRY 391243 >dbj|AP006495.2| Cyanidioschyzon merolae DNA, chromosome 13, complete genome, complete sequence Length = 866983 Score = 27.7 bits (60), Expect = 3.0 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -1 Query: 62 FVCIVTNVASQUGKTEVNYTQLV---DLHARYAECGLRILA 99 + C++T++ G N + L HAR A CG+R++A Sbjct: 546580 YPCLITDILRAFGGMRTNASILYCSKSYHARMAFCGIRLIA 546458 >dbj|AP006492.2| Cyanidioschyzon merolae DNA, chromosome 10, complete genome, complete sequence Length = 839707 Score = 26.6 bits (57), Expect = 6.6 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 107 KQEPGSNEEIKEFAAGYNVKFDMFSK-ICVNGDD 139 KQEP S + + EFA GY +F + C +G D Sbjct: 639895 KQEPCSFQHVHEFAKGYGGTVALFGRGGCGDGSD 639996 Score = 26.2 bits (56), Expect = 8.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 29 CASRDDWRCARSMHEFSAKDIDGH 52 C + D+ R RS ++ +DIDGH Sbjct: 684025 CGASDESRWKRSSSRWTIRDIDGH 684096 Score = 26.2 bits (56), Expect = 8.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 4 GRLCRLLKPALLCGALAAPGLAGTMCAS 31 G+LC A + G L A +AGT+CA+ Sbjct: 732990 GKLCA----AAIAGTLCAAAIAGTLCAA 733061 >dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, complete genome, complete sequence Length = 852727 Score = 26.6 bits (57), Expect = 6.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 18 ALAAPGLAGTMCASRDDWRCARSMHEFSAK 47 A+AAP A + C +R D C R SAK Sbjct: 452373 AVAAPATAASFCDARTDSTCWRQASNRSAK 452284 >dbj|AP006486.2| Cyanidioschyzon merolae DNA, chromosome 4, complete genome, complete sequence Length = 513455 Score = 26.2 bits (56), Expect = 8.6 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = +3 Query: 13 ALLCG--ALAAPGLAGTMCA-SRDDWRCARSMHEFSAK-DIDGHMVNLDKYRGFVCIVTN 68 ALL G A AA AGT+ SR WRCAR + + H V + VC Sbjct: 204900 ALLRGYDAAAAAAAAGTLAVGSRRRWRCARVGRQVIMRVSCLFHKVLFHQRHAVVCESVG 205079 Query: 69 VASQUGKTEV 78 +A G T V Sbjct: 205080 LALVHGPTTV 205109 >dbj|AP006494.2| Cyanidioschyzon merolae DNA, chromosome 12, complete genome, complete sequence Length = 859119 Score = 26.2 bits (56), Expect = 8.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 85 DLHARYAECGLRILAFPCNQ 104 D+HA+ A C +R++ PC Q Sbjct: 820775 DVHAKIALCDIRLVRHPCAQ 820716 >dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence Length = 1621617 Score = 26.2 bits (56), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 139 DAHPLWKWMKIQPKGKG 155 DAH +W W ++ GKG Sbjct: 437681 DAHTIWIWWRLNEPGKG 437631 Database: C.merolae/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 16,546,747 Number of sequences in database: 20 Lambda K H 0.324 0.140 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,111,784 Number of Sequences: 20 Number of extensions: 86913 Number of successful extensions: 489 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 435 Number of HSP's gapped (non-prelim): 167 length of query: 197 length of database: 5,515,582 effective HSP length: 90 effective length of query: 107 effective length of database: 5,513,782 effective search space: 589974674 effective search space used: 589974674 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (26.2 bits)