TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000007_1.0 # Protein # Glutathione peroxidase 4 (GPx4) # Homo sapiens # Complete (197 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01002883.1| Ascogregarina taiwanensis Contig3206, whole g... 27 1.2 gb|ABJQ01002213.1| Ascogregarina taiwanensis Contig2502, whole g... 27 1.6 gb|ABJQ01003819.1| Ascogregarina taiwanensis CLRanP93-D08.b1.ab1... 27 2.1 gb|ABJQ01001052.1| Ascogregarina taiwanensis Contig1213, whole g... 25 4.6 gb|ABJQ01002660.1| Ascogregarina taiwanensis Contig2969, whole g... 25 6.0 gb|ABJQ01002616.1| Ascogregarina taiwanensis Contig2924, whole g... 25 6.0 gb|ABJQ01001931.1| Ascogregarina taiwanensis Contig2180, whole g... 25 6.0 gb|ABJQ01001153.1| Ascogregarina taiwanensis Contig1325, whole g... 25 6.0 gb|ABJQ01003878.1| Ascogregarina taiwanensis CLRanP94-H10.b1.ab1... 25 7.9 >gb|ABJQ01002883.1| Ascogregarina taiwanensis Contig3206, whole genome shotgun sequence Length = 2263 Score = 27.3 bits (59), Expect = 1.2 Identities = 19/74 (25%), Positives = 31/74 (41%) Frame = +3 Query: 67 TNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVK 126 T V + EV L D+ RYA + + PC K+ G + +KE G Sbjct: 774 TRVQDPDSEAEVQAAILEDITRRYAASTPAVCSLPCRLGTKRNKGGHVLVKEEYLG---- 941 Query: 127 FDMFSKICVNGDDA 140 + + +C + D+A Sbjct: 942 -RVDAPVCHSNDNA 980 >gb|ABJQ01002213.1| Ascogregarina taiwanensis Contig2502, whole genome shotgun sequence Length = 1802 Score = 26.9 bits (58), Expect = 1.6 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +2 Query: 131 SKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFL----IDKNGCVV 177 +KIC N D +W K P+ +G+ G + + F+ DK G V Sbjct: 254 AKICSNSDSISGPNRWWKSLPRARGLRGTPLASSDISFMSFTAADKKGRTV 406 >gb|ABJQ01003819.1| Ascogregarina taiwanensis CLRanP93-D08.b1.ab1, whole genome shotgun sequence Length = 749 Score = 26.6 bits (57), Expect = 2.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 5 RLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSM 41 RLC P + G +++PG G +CA W C+R M Sbjct: 263 RLCWCSMPGIW-GRISSPG--GRLCARPGCWSCSRRM 162 >gb|ABJQ01001052.1| Ascogregarina taiwanensis Contig1213, whole genome shotgun sequence Length = 813 Score = 25.4 bits (54), Expect = 4.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 133 ICVNGDDAHPLWKWMK 148 IC GD P+W W K Sbjct: 666 ICKGGDSEKPVWSWPK 713 >gb|ABJQ01002660.1| Ascogregarina taiwanensis Contig2969, whole genome shotgun sequence Length = 2481 Score = 25.0 bits (53), Expect = 6.0 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = -2 Query: 145 KWMKIQPKGKGILGN--AIKW 163 +W+ +QP G+G GN A KW Sbjct: 2297 RWLVLQPYGRGRAGNAAAAKW 2235 Score = 25.0 bits (53), Expect = 6.0 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +1 Query: 145 KWMKIQPKGKGILGN--AIKW 163 +W+ +QP G+G GN A KW Sbjct: 1234 RWLVLQPYGRGRAGNAAAAKW 1296 >gb|ABJQ01002616.1| Ascogregarina taiwanensis Contig2924, whole genome shotgun sequence Length = 1625 Score = 25.0 bits (53), Expect = 6.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 157 LGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 187 LGN+ K + L+DKN Y P+ PL Sbjct: 403 LGNSYKHSCRTLLLDKNHIKQTYYSPIMHPL 311 >gb|ABJQ01001931.1| Ascogregarina taiwanensis Contig2180, whole genome shotgun sequence Length = 1044 Score = 25.0 bits (53), Expect = 6.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 6 LCRLLKPALLCGALAAPGLAGTMCASRD 33 LCR+ + G L + GL+ T+C RD Sbjct: 90 LCRICQRRRSDGVLRSRGLSPTLCVMRD 7 >gb|ABJQ01001153.1| Ascogregarina taiwanensis Contig1325, whole genome shotgun sequence Length = 984 Score = 25.0 bits (53), Expect = 6.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 16 CGALAAPGLAGTMCASRDDWRCARS 40 CG A G +G CAS D C S Sbjct: 850 CGGCCASGDSGGCCASSDSGGCCAS 924 >gb|ABJQ01003878.1| Ascogregarina taiwanensis CLRanP94-H10.b1.ab1, whole genome shotgun sequence Length = 866 Score = 24.6 bits (52), Expect = 7.9 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 Query: 34 DWRCARSMHEFSAKDIDGHMVNLDK 58 DW R +H+++ K ++ H+ K Sbjct: 124 DWEMRRKLHDYAEKQLNMHIAETTK 198 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.324 0.140 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,742,151 Number of Sequences: 5379 Number of extensions: 26470 Number of successful extensions: 154 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of query: 197 length of database: 2,049,803 effective HSP length: 82 effective length of query: 115 effective length of database: 1,608,725 effective search space: 185003375 effective search space used: 185003375 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (24.3 bits)