TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000006_1.0 # Protein # Glutathione peroxidase 3 (GPx3) # Homo sapiens # Complete (226 letters) Database: C.muris/genome.fa 84 sequences; 9,245,251 total letters Searching...................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|DS989726.1| Cryptosporidium muris RN66 scf_1106632373453 geno... 65 1e-11 >gb|DS989726.1| Cryptosporidium muris RN66 scf_1106632373453 genomic scaffold, whole genome shotgun sequence Length = 1324930 Score = 65.1 bits (157), Expect = 1e-11 Identities = 48/155 (30%), Positives = 70/155 (45%), Gaps = 1/155 (0%) Frame = -3 Query: 39 TIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI-ELNALQEELAPFGLVIL 97 + Y+Y T++GE Y P GK V+ NVAS G + +Y ++ + APFG IL Sbjct: 165518 SFYDYTLKTLEGELY-PLSSLKGKVVMITNVASKCGYSYKYYNQMVRMHSVFAPFGFEIL 165342 Query: 98 GFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCP 157 P +F +QE + +I + F F + E +VNGE FLK + P Sbjct: 165341 AIPSREFLRQEYLDPKDIRKAIN------SFNVEFPVMELSNVNGENALDLINFLKFNTP 165180 Query: 158 PTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDG 192 EL + ++ I WNF +FLV G Sbjct: 165179 ---ELYDRNKN------ELKAISWNFSRFLVNKSG 165102 Database: C.muris/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 9,245,251 Number of sequences in database: 84 Lambda K H 0.321 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,235,360 Number of Sequences: 84 Number of extensions: 31132 Number of successful extensions: 91 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 87 Number of HSP's gapped (non-prelim): 9 length of query: 226 length of database: 3,081,750 effective HSP length: 88 effective length of query: 138 effective length of database: 3,074,358 effective search space: 424261404 effective search space used: 424261404 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)