TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000006_1.0 # Protein # Glutathione peroxidase 3 (GPx3) # Homo sapiens # Complete (226 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01002037.1| Ascogregarina taiwanensis Contig2304, whole g... 28 0.67 gb|ABJQ01003078.1| Ascogregarina taiwanensis Contig3411, whole g... 27 1.5 gb|ABJQ01001512.1| Ascogregarina taiwanensis Contig1732, whole g... 25 5.7 gb|ABJQ01002261.1| Ascogregarina taiwanensis Contig2556, whole g... 25 9.7 >gb|ABJQ01002037.1| Ascogregarina taiwanensis Contig2304, whole genome shotgun sequence Length = 943 Score = 28.5 bits (62), Expect = 0.67 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 11/64 (17%) Frame = -1 Query: 68 NVASYUGLTGQY----IELNALQEELAPFGLVILG-------FPCNQFGKQEPGENSEIL 116 N+ASY + + I L AL ++P L LG FPC+ F +SE+ Sbjct: 367 NLASYQSASKSWRGFPISLAALSPSISPGLLGSLGPLRYPSGFPCDSFRSMGRALHSELS 188 Query: 117 PTLK 120 PT+K Sbjct: 187 PTIK 176 >gb|ABJQ01003078.1| Ascogregarina taiwanensis Contig3411, whole genome shotgun sequence Length = 2316 Score = 27.3 bits (59), Expect = 1.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 20 SQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYI 54 S + G ++S CHGGI G I+ A + +E + Sbjct: 1050 SDTNGVKRSSEACHGGILGVIHNTQAYSFSFKEVL 1154 >gb|ABJQ01001512.1| Ascogregarina taiwanensis Contig1732, whole genome shotgun sequence Length = 801 Score = 25.4 bits (54), Expect = 5.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 36 ISGTIYEYGALTIDGEEY 53 I +E G LTIDGEEY Sbjct: 309 IHQAFFEAGRLTIDGEEY 256 >gb|ABJQ01002261.1| Ascogregarina taiwanensis Contig2556, whole genome shotgun sequence Length = 1057 Score = 24.6 bits (52), Expect = 9.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 118 TLKYVRPGGGFVPNFQLFEKGDVNG 142 T K + P G NFQ +KG +NG Sbjct: 922 TQKVIAPAGKGSTNFQ*EQKGSING 996 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.321 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,721,227 Number of Sequences: 5379 Number of extensions: 23803 Number of successful extensions: 99 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of query: 226 length of database: 2,049,803 effective HSP length: 84 effective length of query: 142 effective length of database: 1,597,967 effective search space: 226911314 effective search space used: 226911314 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)