TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: P.tricornutum/genome.fa 31 sequences; 23,733,684 total letters Searching...............................done Score E Sequences producing significant alignments: (bits) Value gb|CM000613.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 80 5e-16 gb|CM000620.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 78 3e-15 gb|CM000605.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 27 5.1 gb|CM000608.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome ... 27 8.7 >gb|CM000613.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 10, whole genome shotgun sequence Length = 976485 Score = 80.5 bits (197), Expect = 5e-16 Identities = 56/162 (34%), Positives = 80/162 (49%), Gaps = 4/162 (2%) Frame = +2 Query: 6 KSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLV-VL 64 +SF+DLSA +DG + F +FRG+ ++ NVAS G T + L EL + V +L Sbjct: 34934 ESFFDLSAKDIDGNAIAFESFRGKVTVLTNVASYCGYTESHYRGLVELWSVMSDKAVEIL 35113 Query: 65 GFPCNQFGHQENCQNEEILN--SLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDK 122 FPCNQFG QE + ++I + S K VR F +++K VNG N H V+ YLK + Sbjct: 35114 AFPCNQFGAQEPEEADKIKDFASSKGVR--------FRIMEKINVNGPNAHQVYKYLKAQ 35269 Query: 123 LPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNF-EKFLIGPEG 163 P + WNF F++GP+G Sbjct: 35270 AGPP----------------------TINWNFGTYFVVGPDG 35329 Score = 26.9 bits (58), Expect = 6.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 51 NELQCRFPRRLVVLGFPCNQ 70 +E+ R PRR+++ GFPC + Sbjct: 829160 DEVTSRTPRRVILWGFPCGE 829101 >gb|CM000620.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 18, whole genome shotgun sequence Length = 702471 Score = 77.8 bits (190), Expect = 3e-15 Identities = 49/120 (40%), Positives = 65/120 (54%), Gaps = 2/120 (1%) Frame = +2 Query: 7 SFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRF-PRRLVVLG 65 SFY + S+DGE V ++F G L+ NVAS G T ++TQL +L + R L +L Sbjct: 446483 SFYSCADKSMDGEAVPMSSFEGNVCLVVNVASK*GLTKMNYTQLPQLVDEYGSRGLKILA 446662 Query: 66 FPCNQFGHQENCQNEEILNSL-KYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLP 124 FPCNQFG QE EEIL + KY + +K +VNG N V++YLK P Sbjct: 446663 FPCNQFGGQEPGSPEEILAFVAKYDKE---MAKKLVFFEKADVNGANTREVYSYLKKTCP 446833 >gb|CM000605.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 1, whole genome shotgun sequence Length = 2535400 Score = 27.3 bits (59), Expect = 5.1 Identities = 17/60 (28%), Positives = 24/60 (40%) Frame = -1 Query: 43 TTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLV 102 TT+DF +E C +V C G C + + +R +PTFTLV Sbjct: 1582849 TTKDFLGTDECSC-----IVSRSDACLIMGVMRTCASVARVQHCSILRESDSQEPTFTLV 1582685 >gb|CM000608.1| Phaeodactylum tricornutum CCAP 1055/1 chromosome 5, whole genome shotgun sequence Length = 1098047 Score = 26.6 bits (57), Expect = 8.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 10 DLSAISLDGEKVDFNTFRGRAVLIENVASL 39 DL +SLD EK+D + R RAV ++ L Sbjct: 776989 DLPILSLDNEKMDLSQIRMRAVAKPHIVYL 776900 Database: P.tricornutum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 23,733,684 Number of sequences in database: 31 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,776,354 Number of Sequences: 31 Number of extensions: 99135 Number of successful extensions: 355 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 335 Number of HSP's gapped (non-prelim): 63 length of query: 190 length of database: 7,911,228 effective HSP length: 92 effective length of query: 98 effective length of database: 7,908,376 effective search space: 775020848 effective search space used: 775020848 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)