TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: C.owczarzaki/genome.fa 89 sequences; 28,043,798 total letters Searching........................................................................................done Score E Sequences producing significant alignments: (bits) Value supercontig_1.15 of Capsaspora owczarzaki ATCC 30864 27 0.036 supercontig_1.3 of Capsaspora owczarzaki ATCC 30864 27 5.9 supercontig_1.8 of Capsaspora owczarzaki ATCC 30864 27 7.8 >supercontig_1.15 of Capsaspora owczarzaki ATCC 30864 Length = 930169 Score = 26.6 bits (57), Expect(2) = 0.036 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 98 TFTLVQKCEVNGQNEHP 114 TF L++K +VNGQ HP Sbjct: 28763 TFQLMEKTKVNGQEAHP 28713 Score = 26.2 bits (56), Expect(2) = 0.036 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 11/83 (13%) Frame = -2 Query: 115 VFAYLKDKL-PYPYDDPFSLMTDPKLIIWS---------PVRRS-DVAWNFEKFLIGPEG 163 V+ +L+ K P P D FS + L+ S P RS +V+ N +FLI G Sbjct: 28620 VYRFLRSKTDPSPIDWNFSKVGCLVLVFCSLPWFCLKTFPT*RSRNVSRNKLQFLIDRTG 28441 Query: 164 EPFRRYSRTFPTINIEPDIKRLL 186 +R+ + IEP+I +LL Sbjct: 28440 STIQRFGASVRPKEIEPEIIKLL 28372 >supercontig_1.3 of Capsaspora owczarzaki ATCC 30864 Length = 2526540 Score = 27.3 bits (59), Expect = 5.9 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +1 Query: 80 EEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYD 128 E LN+LK Y F +Q CEV+ +N + + K + PY ++ Sbjct: 1812949 ERSLNNLKKGNVQKSY--VFADIQSCEVDVRNPTRLLVHFKSRTPYVFN 1813089 Score = 26.9 bits (58), Expect = 7.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 62 VVLGFPCNQFGHQENCQNEEILNSLKY 88 + +G+ C Q G ++ C+N N LKY Sbjct: 2169324 IPVGWDCTQRGFKKTCENTTNKNGLKY 2169404 >supercontig_1.8 of Capsaspora owczarzaki ATCC 30864 Length = 1512001 Score = 26.9 bits (58), Expect = 7.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 48 TQLNELQCRFPRRLVVLGFPCNQFGHQE 75 TQL + RF R VVL F NQ G +E Sbjct: 210145 TQLRRSRLRFSLRQVVLSFAVNQSGGRE 210228 Score = 26.9 bits (58), Expect = 7.8 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = -1 Query: 56 RFPRRLVVLGFPC-----NQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQ 110 R+PR+ + GF C +FG ++ Q++ ++ V+ G Q LVQ+ V G Sbjct: 560755 RWPRKQMRCGFSCLRIAQKEFGRRDRIQHQIVVQC--NVKVVGVVQQLAFLVQRAHVVGH 560582 Query: 111 NEHPVFAYLKDK 122 V A KD+ Sbjct: 560581 RIGRVGALDKDR 560546 Database: C.owczarzaki/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 28,043,798 Number of sequences in database: 89 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,374,220 Number of Sequences: 89 Number of extensions: 102971 Number of successful extensions: 377 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 336 Number of HSP's gapped (non-prelim): 72 length of query: 190 length of database: 9,347,932 effective HSP length: 93 effective length of query: 97 effective length of database: 9,339,655 effective search space: 905946535 effective search space used: 905946535 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)