TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: C.muris/genome.fa 84 sequences; 9,245,251 total letters Searching...................................................................................done Score E Sequences producing significant alignments: (bits) Value gb|DS989726.1| Cryptosporidium muris RN66 scf_1106632373453 geno... 66 4e-12 gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 geno... 25 8.0 gb|DS989727.1| Cryptosporidium muris RN66 scf_1106632353999 geno... 25 8.0 >gb|DS989726.1| Cryptosporidium muris RN66 scf_1106632373453 genomic scaffold, whole genome shotgun sequence Length = 1324930 Score = 66.2 bits (160), Expect = 4e-12 Identities = 47/184 (25%), Positives = 81/184 (44%), Gaps = 1/184 (0%) Frame = -3 Query: 6 KSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRF-PRRLVVL 64 KSFYD + +L+GE ++ +G+ V+I NVAS G + + + Q+ + F P +L Sbjct: 165521 KSFYDYTLKTLEGELYPLSSLKGKVVMITNVASKCGYSYKYYNQMVRMHSVFAPFGFEIL 165342 Query: 65 GFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLP 124 P +F QE ++I ++ + F +++ VNG+N + +LK P Sbjct: 165341 AIPSREFLRQEYLDPKDIRKAI------NSFNVEFPVMELSNVNGENALDLINFLKFNTP 165180 Query: 125 YPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKR 184 YD + ++WNF +FL+ G+ + T + P I Sbjct: 165179 ELYDR-------------NKNELKAISWNFSRFLVNKSGQVVAFRTTTTSPEELIPKIAE 165039 Query: 185 LLKV 188 LL V Sbjct: 165038 LLNV 165027 >gb|DS989728.1| Cryptosporidium muris RN66 scf_1106632373407 genomic scaffold, whole genome shotgun sequence Length = 965821 Score = 25.4 bits (54), Expect = 8.0 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 95 YQPTFTLVQKCEVNGQNEHPVFAY--LKDKLPYPYDD 129 Y+ L+ + E+N QN F+Y + +KL Y DD Sbjct: 94584 YKDIIILLNEMEINNQNMPIPFSYVPILEKLQYQIDD 94474 >gb|DS989727.1| Cryptosporidium muris RN66 scf_1106632353999 genomic scaffold, whole genome shotgun sequence Length = 1306717 Score = 25.4 bits (54), Expect = 8.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 152 WNFEKFLIGPEGEPFRRYSRTFPT 175 WN + ++ +G PF + TFPT Sbjct: 1053468 WNIHQIIVRAQGFPFLCF*TTFPT 1053397 Database: C.muris/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 9,245,251 Number of sequences in database: 84 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,859,740 Number of Sequences: 84 Number of extensions: 26533 Number of successful extensions: 87 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 79 Number of HSP's gapped (non-prelim): 34 length of query: 190 length of database: 3,081,750 effective HSP length: 86 effective length of query: 104 effective length of database: 3,074,526 effective search space: 319750704 effective search space used: 319750704 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)