TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: C.merolae/genome.fa 20 sequences; 16,546,747 total letters Searching....................done Score E Sequences producing significant alignments: (bits) Value dbj|AP006487.2| Cyanidioschyzon merolae DNA, chromosome 5, compl... 28 1.6 dbj|AP006484.2| Cyanidioschyzon merolae DNA, chromosome 2, compl... 28 2.1 dbj|AP006500.2| Cyanidioschyzon merolae DNA, chromosome 18, comp... 28 2.1 dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, comp... 28 2.8 dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, comp... 27 3.6 dbj|AP006493.2| Cyanidioschyzon merolae DNA, chromosome 11, comp... 27 6.2 dbj|AP006483.2| Cyanidioschyzon merolae DNA, chromosome 1, compl... 26 8.1 dbj|AP006494.2| Cyanidioschyzon merolae DNA, chromosome 12, comp... 26 8.1 >dbj|AP006487.2| Cyanidioschyzon merolae DNA, chromosome 5, complete genome, complete sequence Length = 528682 Score = 28.5 bits (62), Expect = 1.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 130 PFSLMTDPKLIIWSPVRRSDVAWNF 154 PF+ +P+ + W RSDVAW F Sbjct: 461453 PFNSWCEPQALSWWVQSRSDVAWGF 461527 >dbj|AP006484.2| Cyanidioschyzon merolae DNA, chromosome 2, complete genome, complete sequence Length = 457013 Score = 28.1 bits (61), Expect = 2.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 118 YLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKF 157 Y K+P+ P S+ + KL+ + +S AW EK+ Sbjct: 187522 YFAQKMPFRGPPPRSVRRNKKLLFSKRIGKSSNAWGIEKY 187403 >dbj|AP006500.2| Cyanidioschyzon merolae DNA, chromosome 18, complete genome, complete sequence Length = 1253087 Score = 28.1 bits (61), Expect = 2.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 30 AVLIENVASLUGTTTRDFTQLNELQCRF 57 A ++++VAS+ T TR T EL+CRF Sbjct: 442890 ASVVDDVASIEVTGTRPATCATELECRF 442973 Score = 26.2 bits (56), Expect = 8.1 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 100 TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRS 148 +LV+ E NG+ P + + DP S+ +P+ +W P+R+S Sbjct: 686054 SLVR*IESNGRRPPPKLVHFSSECSN--SDPCSVTRNPRKSLW*PLRQS 685914 >dbj|AP006502.2| Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence Length = 1621617 Score = 27.7 bits (60), Expect = 2.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 121 DKLPYPYDDPFSLMTDPKLIIWSPVRRS 148 D PY + DP SL T K++ +P+R S Sbjct: 940607 DTSPYTHSDPESLATAVKVVSLTPIRAS 940690 >dbj|AP006496.2| Cyanidioschyzon merolae DNA, chromosome 14, complete genome, complete sequence Length = 852727 Score = 27.3 bits (59), Expect = 3.6 Identities = 21/79 (26%), Positives = 38/79 (48%) Frame = +2 Query: 9 YDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPC 68 + +I++ ++ + R R IE+ SL G+ R L Q R+ V +G PC Sbjct: 443189 FTTDSIAIHHSSLESSALRLRTQRIEH--SLRGSLRRSPRSLTTAQNTSMRKGVSIGAPC 443362 Query: 69 NQFGHQENCQNEEILNSLK 87 + GH + +E +++LK Sbjct: 443363 TRPGH--DASDETSVHALK 443413 >dbj|AP006493.2| Cyanidioschyzon merolae DNA, chromosome 11, complete genome, complete sequence Length = 852849 Score = 26.6 bits (57), Expect = 6.2 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = -2 Query: 76 NCQNEEILNSLK-----YVRPGGGYQPTFTLVQK 104 +C E L L YVRPG G+ T +VQK Sbjct: 630188 HCSLHEALEPLSKVPRTYVRPGNGFMTTTRMVQK 630087 >dbj|AP006483.2| Cyanidioschyzon merolae DNA, chromosome 1, complete genome, complete sequence Length = 422616 Score = 26.2 bits (56), Expect = 8.1 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 46 DFTQLNELQCRFPRRLV-VLGFPCNQF 71 D +Q+N ++CR RR VLG C +F Sbjct: 150915 DMSQINHIKCRQIRRQTRVLGMACGRF 150995 >dbj|AP006494.2| Cyanidioschyzon merolae DNA, chromosome 12, complete genome, complete sequence Length = 859119 Score = 26.2 bits (56), Expect = 8.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 45 RDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQN 79 R+ + CR P++ +LG N GHQ + N Sbjct: 265720 RELCSVPVASCRAPQQATILGCQPNARGHQRSAYN 265824 Database: C.merolae/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 16,546,747 Number of sequences in database: 20 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,805,631 Number of Sequences: 20 Number of extensions: 61179 Number of successful extensions: 204 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 176 Number of HSP's gapped (non-prelim): 60 length of query: 190 length of database: 5,515,582 effective HSP length: 90 effective length of query: 100 effective length of database: 5,513,782 effective search space: 551378200 effective search space used: 551378200 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)