TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01002315.1| Ascogregarina taiwanensis Contig2613, whole g... 28 0.67 gb|ABJQ01003201.1| Ascogregarina taiwanensis Contig3535, whole g... 25 4.3 gb|ABJQ01003152.1| Ascogregarina taiwanensis Contig3486, whole g... 25 4.3 gb|ABJQ01003087.1| Ascogregarina taiwanensis Contig3420, whole g... 25 4.3 gb|ABJQ01002505.1| Ascogregarina taiwanensis Contig2811, whole g... 25 4.3 gb|ABJQ01002788.1| Ascogregarina taiwanensis Contig3107, whole g... 25 5.7 gb|ABJQ01002443.1| Ascogregarina taiwanensis Contig2749, whole g... 25 7.4 >gb|ABJQ01002315.1| Ascogregarina taiwanensis Contig2613, whole genome shotgun sequence Length = 3192 Score = 28.1 bits (61), Expect = 0.67 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = -2 Query: 109 GQNEHPVFAYLKDKLPYPYDDPF------SLMTDPK---LIIWSPVRRSDVAW 152 G+ EH + Y++ + YP D F S PK L +WS R SD AW Sbjct: 1115 GEGEHKIMQYIRSQRTYPE*DIFVCYLIASFQL*PKSATLSVWSR-RGSDYAW 960 >gb|ABJQ01003201.1| Ascogregarina taiwanensis Contig3535, whole genome shotgun sequence Length = 3743 Score = 25.4 bits (54), Expect = 4.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 137 PKLIIWSPVRRSDVAWNFEKFLIGP 161 P++++ RRSD AW++ F I P Sbjct: 3134 PRMVLQPNRRRSDRAWHYVPFEIDP 3060 >gb|ABJQ01003152.1| Ascogregarina taiwanensis Contig3486, whole genome shotgun sequence Length = 2227 Score = 25.4 bits (54), Expect = 4.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 137 PKLIIWSPVRRSDVAWNFEKFLIGP 161 P++++ RRSD AW++ F I P Sbjct: 248 PRMVLQPNRRRSDRAWHYVPFEIDP 174 >gb|ABJQ01003087.1| Ascogregarina taiwanensis Contig3420, whole genome shotgun sequence Length = 1938 Score = 25.4 bits (54), Expect = 4.3 Identities = 15/63 (23%), Positives = 28/63 (44%) Frame = -3 Query: 14 ISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGH 73 +S G VD + G + + + + +L + T+ + ELQCR+ ++L G Sbjct: 1162 LSFGGNSVDISD--GDSTVNDTLTNLAHSLTKYIQSIQELQCRYDLARLLLSLSLRAAGA 989 Query: 74 QEN 76 N Sbjct: 988 AGN 980 >gb|ABJQ01002505.1| Ascogregarina taiwanensis Contig2811, whole genome shotgun sequence Length = 1434 Score = 25.4 bits (54), Expect = 4.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 137 PKLIIWSPVRRSDVAWNFEKFLIGP 161 P++++ RRSD AW++ F I P Sbjct: 1093 PRMVLQPNHRRSDRAWDYVPFEIDP 1167 >gb|ABJQ01002788.1| Ascogregarina taiwanensis Contig3107, whole genome shotgun sequence Length = 1635 Score = 25.0 bits (53), Expect = 5.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 160 GPEGEPFRRYSRTFPTINIEPDIKRLLK 187 GP+ P R+ ++ P + +PDI L+ Sbjct: 1487 GPKTPPLRQLAQPAPAVQFDPDISTRLQ 1404 >gb|ABJQ01002443.1| Ascogregarina taiwanensis Contig2749, whole genome shotgun sequence Length = 1272 Score = 24.6 bits (52), Expect = 7.4 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 165 PFRRYSRTFPTINIEPDI 182 PF R + +FP I++EPD+ Sbjct: 1051 PFLRDAFSFPYISVEPDV 1104 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,414,095 Number of Sequences: 5379 Number of extensions: 21645 Number of successful extensions: 144 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of query: 190 length of database: 2,049,803 effective HSP length: 82 effective length of query: 108 effective length of database: 1,608,725 effective search space: 173742300 effective search space used: 173742300 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)