TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) # Homo sapiens # Complete (203 letters) Database: P.pallidum/genome.fa 42 sequences; 32,942,533 total letters Searching..........................................done Score E Sequences producing significant alignments: (bits) Value gb|GL290996.1| Polysphondylium pallidum PN500 unplaced genomic s... 91 4e-21 >gb|GL290996.1| Polysphondylium pallidum PN500 unplaced genomic scaffold PPL_scaffold14, whole genome shotgun sequence Length = 1054919 Score = 90.5 bits (223), Expect = 7e-19 Identities = 53/151 (35%), Positives = 73/151 (48%), Gaps = 30/151 (19%) Frame = +2 Query: 60 NELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCE--- 116 N+L + G V+LGFPC QF +Q +EIL +LKY+RPG GF+P F +F K Sbjct: 66077 NDLVEKFGTTEFVILGFPCAQFMNQSPGSGDEILLTLKYIRPGNGFQPAFPMFAKVNNNN 66256 Query: 117 -------------------------VNG--AGAHPLFAFLREALPAPSDDATALMTDPKL 149 VNG + +P+F +L+ T + + L Sbjct: 66257 SL*N**NLILMHFQPNFLYDPLQSNVNGDPSTVNPVFNWLKSGC----GPITQTILETSL 66424 Query: 150 ITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS 180 I+W+PV ND+ WNFEKFLV G +RYS Sbjct: 66425 ISWTPVMTNDITWNFEKFLVSKTGQLYKRYS 66517 Score = 64.3 bits (155), Expect(2) = 4e-21 Identities = 29/71 (40%), Positives = 42/71 (59%) Frame = +1 Query: 44 NVASLXGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGG 103 ++ +L + + NEL + G +LGFPC+QF +Q ++E L +LKYVRPG Sbjct: 68080 SILTLKSKFINTFIGCNELVEKYGTEEFAILGFPCSQFMNQAPGSDQEFLLTLKYVRPGD 68259 Query: 104 GFEPNFMLFEK 114 F PNF+LF K Sbjct: 68260 NFVPNFLLFTK 68292 Score = 54.3 bits (129), Expect(2) = 4e-21 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = +2 Query: 124 PLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS 180 P+F +LR A S + D LI+W+PV ND+ WNFEKFLV G +RRYS Sbjct: 68408 PVFQWLRSGCGATSQT----IIDTSLISWTPVLTNDITWNFEKFLVSKTGQLVRRYS 68566 Database: P.pallidum/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 32,942,533 Number of sequences in database: 42 Lambda K H 0.321 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,539,486 Number of Sequences: 42 Number of extensions: 68344 Number of successful extensions: 195 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 190 Number of HSP's gapped (non-prelim): 11 length of query: 203 length of database: 10,980,844 effective HSP length: 95 effective length of query: 108 effective length of database: 10,976,854 effective search space: 1185500232 effective search space used: 1185500232 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.9 bits)